BLASTX nr result
ID: Anemarrhena21_contig00032237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00032237 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_009216681.1| ribonuclease H [Bacteroidetes oral taxon 274... 66 8e-09 >ref|WP_009216681.1| ribonuclease H [Bacteroidetes oral taxon 274] gi|298275117|gb|EFI16668.1| ribonuclease H [Bacteroidetes oral taxon 274 str. F0058] Length = 207 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/45 (60%), Positives = 36/45 (80%) Frame = -2 Query: 238 LARKNFYVVKRGQQCGIFDN*EDCKSQVDKFPNVSYKGYATYEEA 104 +A+ FYVV RG++CGIFDN +DCK+Q+DKF YKG+ATY +A Sbjct: 1 MAKNKFYVVWRGRRCGIFDNWDDCKAQIDKFEGAVYKGFATYSQA 45