BLASTX nr result
ID: Anemarrhena21_contig00032169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00032169 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officin... 62 2e-07 gb|ABD63151.1| hypothetical protein 20.t00003 [Asparagus officin... 60 4e-07 >gb|ABB55338.1| hypothetical protein 16.t00009 [Asparagus officinalis] Length = 1322 Score = 62.0 bits (149), Expect = 2e-07 Identities = 36/110 (32%), Positives = 49/110 (44%), Gaps = 2/110 (1%) Frame = +2 Query: 2 WDLVDEIASLPSGHITSSGGRGLGHQRFLALFPGSRTSDLPV-NYQPAAVPTFMNRFMAV 178 W L E S+ G+IT G + L PG D P N T NR + Sbjct: 228 WSLTKEHESVHCGYITHQAVPGSSRDHIVGLHPGVLGLDTPPRNEFLTTASTLRNRLAIL 287 Query: 179 GGNYPGSGFRMNGWVSNQQR-WWIDLSTFILQHFASELQSIGLYDAVRAT 325 G P R GWV + R WW ++ ++L ++ EL + GLY A+RAT Sbjct: 288 GREMPAPRHRFYGWVHSLDRFWWARMTKYVLSRWSEELHACGLYAAIRAT 337 >gb|ABD63151.1| hypothetical protein 20.t00003 [Asparagus officinalis] Length = 1011 Score = 60.5 bits (145), Expect = 4e-07 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 2/110 (1%) Frame = +2 Query: 2 WDLVDEIASLPSGHITSSGGRGLGHQRFLALFPGSRTSDLPV-NYQPAAVPTFMNRFMAV 178 W L +E S+ G+IT G + L G D P N A+ T NR + Sbjct: 155 WRLTEEHESIHCGYITHQAALGSSRSHIIGLRSGVLGLDTPPRNEFLASASTLKNRLADL 214 Query: 179 GGNYPGSGFRMNGWVSNQQR-WWIDLSTFILQHFASELQSIGLYDAVRAT 325 G P + R GWV + + WW ++ ++L ++ EL + GLY A+R+T Sbjct: 215 GREMPATHHRFYGWVHSLDKLWWARMTKYVLSRWSEELHACGLYAAIRST 264