BLASTX nr result
ID: Anemarrhena21_contig00032025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00032025 (310 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010937605.1| PREDICTED: telomere repeat-binding protein 5... 57 4e-06 ref|XP_008801908.1| PREDICTED: telomere repeat-binding protein 5... 57 4e-06 ref|XP_008784600.1| PREDICTED: telomere repeat-binding protein 5... 56 8e-06 >ref|XP_010937605.1| PREDICTED: telomere repeat-binding protein 5-like [Elaeis guineensis] Length = 709 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 310 QALLDRVLLAHAYWSQQQAKLQSKSPPTEACLLI 209 Q LLDRVL AHAYWSQQQA+LQ K PP E CLL+ Sbjct: 676 QELLDRVLSAHAYWSQQQARLQVKPPPAETCLLL 709 >ref|XP_008801908.1| PREDICTED: telomere repeat-binding protein 5-like [Phoenix dactylifera] Length = 440 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -1 Query: 310 QALLDRVLLAHAYWSQQQAKLQSKSPPTEACLLI 209 Q LLDRVL AHAYWSQQQA+LQ K PP E CLL+ Sbjct: 407 QELLDRVLSAHAYWSQQQARLQVKPPPAETCLLL 440 >ref|XP_008784600.1| PREDICTED: telomere repeat-binding protein 5 [Phoenix dactylifera] gi|672122535|ref|XP_008784601.1| PREDICTED: telomere repeat-binding protein 5 [Phoenix dactylifera] Length = 704 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 310 QALLDRVLLAHAYWSQQQAKLQSKSPPTEACLLI 209 Q LLDRVL AHAYWSQQQA+LQ K PP + CLL+ Sbjct: 671 QELLDRVLSAHAYWSQQQARLQVKPPPAQTCLLL 704