BLASTX nr result
ID: Anemarrhena21_contig00031912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00031912 (624 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012082168.1| PREDICTED: probable polygalacturonase At3g15... 58 3e-06 >ref|XP_012082168.1| PREDICTED: probable polygalacturonase At3g15720 [Jatropha curcas] gi|643717926|gb|KDP29312.1| hypothetical protein JCGZ_19407 [Jatropha curcas] Length = 398 Score = 58.2 bits (139), Expect = 3e-06 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +2 Query: 266 PQQLSFSGCNGLHMIDMKLVNSQRNHLSVSGCSDVLISRLTITAP 400 P LSF CNGL + +K +NSQRNH+S++GCSDV + L ITAP Sbjct: 143 PTALSFHNCNGLQLSGLKHLNSQRNHISINGCSDVNLFHLYITAP 187