BLASTX nr result
ID: Anemarrhena21_contig00031675
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00031675 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009407891.1| PREDICTED: G-type lectin S-receptor-like ser... 56 8e-06 >ref|XP_009407891.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 [Musa acuminata subsp. malaccensis] Length = 820 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/60 (51%), Positives = 39/60 (65%) Frame = -2 Query: 210 FVLTLKNDGSLVLNTVAYPTSNKYAAYWSTPNETDAGVNPLVFNETIGSLYLSFPNGSMV 31 F L + DG+LVL +A PT N+Y AYWST T N LV+NET GSLY + NG++V Sbjct: 195 FQLVAQTDGNLVLYPLALPTGNQYVAYWST--GTTGSGNQLVYNET-GSLYYAVSNGTIV 251