BLASTX nr result
ID: Anemarrhena21_contig00030370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00030370 (314 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012484752.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_012484752.1| PREDICTED: pentatricopeptide repeat-containing protein At4g18840 [Gossypium raimondii] gi|763767696|gb|KJB34911.1| hypothetical protein B456_006G090000 [Gossypium raimondii] Length = 534 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = -2 Query: 313 GNFEMGKYVTKHLLELNPIDACCYCSF*SL*G*--KYQDFLKG*KKVRSSRIGKVLACSL 140 GN +M +YV + LLELNP D+ Y + ++ D L KK+++ ++ K CS+ Sbjct: 456 GNVKMAEYVARKLLELNPQDSSGYVQLSNTYAALKRWDDVLNVRKKMKALKVNKEPGCSM 515 Query: 139 VEVNGVVHEFREGGG 95 +EVNGVVHEF G G Sbjct: 516 IEVNGVVHEFLAGEG 530