BLASTX nr result
ID: Anemarrhena21_contig00030213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00030213 (221 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010910509.1| PREDICTED: putative disease resistance prote... 59 1e-06 ref|XP_008810904.1| PREDICTED: putative disease resistance prote... 57 5e-06 ref|XP_010927751.1| PREDICTED: putative disease resistance prote... 57 6e-06 >ref|XP_010910509.1| PREDICTED: putative disease resistance protein RGA3 [Elaeis guineensis] Length = 1215 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = +3 Query: 51 MVTIRGCEQLQSVVGMHLMDSLEELSILDCPNVQLSLEE-LPSTLKSLALEDCWSLKS 221 MV I GC+QL+S+ G+H + SL EL+I DCP +QL EE LPS L++L +E C L S Sbjct: 920 MVCISGCQQLKSIAGLHNLHSLVELTIKDCPLLQLLSEEGLPSKLQNLHIEGCQQLTS 977 >ref|XP_008810904.1| PREDICTED: putative disease resistance protein RGA3 [Phoenix dactylifera] Length = 1202 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/57 (50%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = +3 Query: 54 VTIRGCEQLQSVVGMHLMDSLEELSILDCPNVQLSLEE-LPSTLKSLALEDCWSLKS 221 V I GC QL S+VG+H + SL++L I +CP +QL EE LPS L+ L +E+C L S Sbjct: 877 VYISGCRQLTSIVGLHHLHSLKDLKIYNCPQLQLLSEEGLPSNLQGLHIEECRQLTS 933 >ref|XP_010927751.1| PREDICTED: putative disease resistance protein RGA4 [Elaeis guineensis] Length = 637 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/57 (50%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = +3 Query: 54 VTIRGCEQLQSVVGMHLMDSLEELSILDCPNVQ-LSLEELPSTLKSLALEDCWSLKS 221 V + GC QL S+ G+H + SLEEL I CP +Q LS E LPS L+ L +E+C L S Sbjct: 275 VYLSGCRQLTSIAGLHNLHSLEELDIYKCPQLQLLSKERLPSKLQYLHIEECQQLSS 331