BLASTX nr result
ID: Anemarrhena21_contig00029961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00029961 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010907825.1| PREDICTED: F-box protein At4g18380-like [Ela... 65 2e-08 ref|XP_010246617.1| PREDICTED: F-box protein At4g18380-like [Nel... 64 5e-08 ref|XP_010907539.1| PREDICTED: F-box protein At4g18380-like [Ela... 63 7e-08 ref|XP_008804990.1| PREDICTED: F-box protein At4g18380-like isof... 63 7e-08 ref|XP_008804989.1| PREDICTED: F-box protein At4g18380-like isof... 63 7e-08 ref|XP_008777014.1| PREDICTED: F-box protein At4g18380-like [Pho... 62 1e-07 ref|XP_010270680.1| PREDICTED: F-box protein At4g18380-like [Nel... 62 2e-07 ref|XP_009420961.1| PREDICTED: F-box protein At4g18380-like [Mus... 61 3e-07 ref|NP_001145883.1| uncharacterized protein LOC100279399 [Zea ma... 60 4e-07 gb|ACG24953.1| F-box domain containing protein [Zea mays] 60 4e-07 ref|XP_008654796.1| PREDICTED: uncharacterized protein LOC100279... 60 4e-07 ref|XP_004961674.1| PREDICTED: F-box protein At4g18380-like [Set... 60 4e-07 gb|ACG44263.1| F-box domain containing protein [Zea mays] 60 6e-07 ref|NP_001130615.1| uncharacterized LOC100191714 [Zea mays] gi|1... 60 6e-07 ref|NP_001055899.2| Os05g0490300, partial [Oryza sativa Japonica... 60 6e-07 gb|AAT69637.1| unknown protein, contains f-box domain [Oryza sat... 60 6e-07 ref|XP_006654574.1| PREDICTED: F-box protein At4g18380-like [Ory... 60 7e-07 ref|XP_002456519.1| hypothetical protein SORBIDRAFT_03g037710 [S... 60 7e-07 ref|XP_006836201.1| PREDICTED: F-box protein At4g18380 [Amborell... 59 1e-06 ref|XP_002441291.1| hypothetical protein SORBIDRAFT_09g023970 [S... 59 1e-06 >ref|XP_010907825.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis] Length = 354 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE+E F+SGAFDGP KA VKALVKRRTYLLEMNGF Sbjct: 320 KEVEAFISGAFDGPFKAAVKALVKRRTYLLEMNGF 354 >ref|XP_010246617.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] gi|720095246|ref|XP_010246618.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] gi|720095249|ref|XP_010246619.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] gi|720095253|ref|XP_010246620.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] gi|720095256|ref|XP_010246621.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] Length = 351 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE+E FV GAFDGP KA VKALVKRRTYLLEMNGF Sbjct: 317 KEVEAFVHGAFDGPFKAAVKALVKRRTYLLEMNGF 351 >ref|XP_010907539.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis] gi|743876250|ref|XP_010907541.1| PREDICTED: F-box protein At4g18380-like [Elaeis guineensis] Length = 354 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FVSGAFDGP KA KALVKRRTYLLEMNGF Sbjct: 320 KEAEAFVSGAFDGPFKAAAKALVKRRTYLLEMNGF 354 >ref|XP_008804990.1| PREDICTED: F-box protein At4g18380-like isoform X2 [Phoenix dactylifera] Length = 354 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FVSGAFDGP KA KALVKRRTYLLEMNGF Sbjct: 320 KEAEAFVSGAFDGPFKAAAKALVKRRTYLLEMNGF 354 >ref|XP_008804989.1| PREDICTED: F-box protein At4g18380-like isoform X1 [Phoenix dactylifera] Length = 421 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FVSGAFDGP KA KALVKRRTYLLEMNGF Sbjct: 387 KEAEAFVSGAFDGPFKAAAKALVKRRTYLLEMNGF 421 >ref|XP_008777014.1| PREDICTED: F-box protein At4g18380-like [Phoenix dactylifera] Length = 354 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FVSGAFDGP K VKAL+KRRTYLLEMNGF Sbjct: 320 KEAEAFVSGAFDGPFKVAVKALLKRRTYLLEMNGF 354 >ref|XP_010270680.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] gi|720047032|ref|XP_010270681.1| PREDICTED: F-box protein At4g18380-like [Nelumbo nucifera] Length = 351 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -2 Query: 344 EMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 E+E FV GAFDGP KA VKALVKRRTYLLEMNGF Sbjct: 318 EVEAFVHGAFDGPFKAAVKALVKRRTYLLEMNGF 351 >ref|XP_009420961.1| PREDICTED: F-box protein At4g18380-like [Musa acuminata subsp. malaccensis] Length = 348 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E F+ GAFDGP +A VKALVKRRTYLLEMNGF Sbjct: 314 KEAEAFICGAFDGPFRAAVKALVKRRTYLLEMNGF 348 >ref|NP_001145883.1| uncharacterized protein LOC100279399 [Zea mays] gi|219884823|gb|ACL52786.1| unknown [Zea mays] Length = 354 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FV GAFDGP KA VKAL+KRRTYLLEMNGF Sbjct: 320 KEAEGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF 354 >gb|ACG24953.1| F-box domain containing protein [Zea mays] Length = 354 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FV GAFDGP KA VKAL+KRRTYLLEMNGF Sbjct: 320 KEAEGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF 354 >ref|XP_008654796.1| PREDICTED: uncharacterized protein LOC100279399 isoform X1 [Zea mays] gi|194702530|gb|ACF85349.1| unknown [Zea mays] gi|413949706|gb|AFW82355.1| F-box domain containing protein isoform 1 [Zea mays] gi|413949707|gb|AFW82356.1| F-box domain containing protein isoform 2 [Zea mays] Length = 354 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE E FV GAFDGP KA VKAL+KRRTYLLEMNGF Sbjct: 320 KEAEGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF 354 >ref|XP_004961674.1| PREDICTED: F-box protein At4g18380-like [Setaria italica] Length = 354 Score = 60.5 bits (145), Expect = 4e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + F+SGAFDGP K VKAL+KRRTYLLEMNGF Sbjct: 320 KETDAFISGAFDGPFKVAVKALMKRRTYLLEMNGF 354 >gb|ACG44263.1| F-box domain containing protein [Zea mays] Length = 354 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + FV GAFDGP KA VKAL+KRRTYLLEMNGF Sbjct: 320 KEADAFVFGAFDGPFKAAVKALMKRRTYLLEMNGF 354 >ref|NP_001130615.1| uncharacterized LOC100191714 [Zea mays] gi|194689642|gb|ACF78905.1| unknown [Zea mays] gi|194693974|gb|ACF81071.1| unknown [Zea mays] gi|219885075|gb|ACL52912.1| unknown [Zea mays] gi|238009120|gb|ACR35595.1| unknown [Zea mays] gi|413945825|gb|AFW78474.1| F-box domain containing protein isoform 1 [Zea mays] gi|413945826|gb|AFW78475.1| F-box domain containing protein isoform 2 [Zea mays] Length = 354 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + FV GAFDGP KA VKAL+KRRTYLLEMNGF Sbjct: 320 KEADAFVFGAFDGPFKAAVKALMKRRTYLLEMNGF 354 >ref|NP_001055899.2| Os05g0490300, partial [Oryza sativa Japonica Group] gi|255676456|dbj|BAF17813.2| Os05g0490300, partial [Oryza sativa Japonica Group] Length = 450 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + FVSGAFDGP K VKAL+KRRTYLLEMNGF Sbjct: 416 KETDAFVSGAFDGPFKFAVKALMKRRTYLLEMNGF 450 >gb|AAT69637.1| unknown protein, contains f-box domain [Oryza sativa Japonica Group] gi|125552803|gb|EAY98512.1| hypothetical protein OsI_20423 [Oryza sativa Indica Group] gi|215701287|dbj|BAG92711.1| unnamed protein product [Oryza sativa Japonica Group] gi|222632054|gb|EEE64186.1| hypothetical protein OsJ_19018 [Oryza sativa Japonica Group] Length = 351 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + FVSGAFDGP K VKAL+KRRTYLLEMNGF Sbjct: 317 KETDAFVSGAFDGPFKFAVKALMKRRTYLLEMNGF 351 >ref|XP_006654574.1| PREDICTED: F-box protein At4g18380-like [Oryza brachyantha] Length = 352 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + F+SGAFDGP K VKAL+KRRTYLLEMNGF Sbjct: 318 KESDAFISGAFDGPFKFAVKALMKRRTYLLEMNGF 352 >ref|XP_002456519.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor] gi|241928494|gb|EES01639.1| hypothetical protein SORBIDRAFT_03g037710 [Sorghum bicolor] Length = 354 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE++ FVSGAFDGPL+ KAL+KRRTYLLEMNGF Sbjct: 320 KEVDAFVSGAFDGPLRFAAKALMKRRTYLLEMNGF 354 >ref|XP_006836201.1| PREDICTED: F-box protein At4g18380 [Amborella trichopoda] gi|769820459|ref|XP_011620703.1| PREDICTED: F-box protein At4g18380 [Amborella trichopoda] gi|548838701|gb|ERM99054.1| hypothetical protein AMTR_s00101p00078790 [Amborella trichopoda] Length = 348 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 +E E FV GAFDGP KA VKALVKRRTYLLEMN F Sbjct: 314 REAEAFVCGAFDGPFKAAVKALVKRRTYLLEMNSF 348 >ref|XP_002441291.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor] gi|241946576|gb|EES19721.1| hypothetical protein SORBIDRAFT_09g023970 [Sorghum bicolor] Length = 354 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -2 Query: 347 KEMETFVSGAFDGPLKAVVKALVKRRTYLLEMNGF 243 KE + FV GAFDGP KA VKAL+KRRTYLLEMNGF Sbjct: 320 KEADGFVFGAFDGPFKAAVKALMKRRTYLLEMNGF 354