BLASTX nr result
ID: Anemarrhena21_contig00028746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00028746 (426 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009420918.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_008787150.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_002282049.1| PREDICTED: pentatricopeptide repeat-containi... 53 4e-06 >ref|XP_009420918.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Musa acuminata subsp. malaccensis] Length = 746 Score = 59.3 bits (142), Expect = 1e-06 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 6/73 (8%) Frame = -1 Query: 294 SNNRIPLIRSCSSMI*RLQ-----MRSSLFQDPLISYAFVSRATLSP-HDLGCSRLVFGQ 133 S + IPLIRSCS+ LQ +RS L DP IS AF+SRA L+P DLG SRLVF + Sbjct: 169 SGDCIPLIRSCSTKAHLLQIHARLLRSDLVHDPTISTAFLSRAALAPLRDLGYSRLVFER 228 Query: 132 IISPNVFQYDSTL 94 I P+VF ++ L Sbjct: 229 IPRPSVFHCNALL 241 >ref|XP_008787150.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530, partial [Phoenix dactylifera] Length = 602 Score = 57.4 bits (137), Expect = 4e-06 Identities = 43/97 (44%), Positives = 53/97 (54%), Gaps = 6/97 (6%) Frame = -1 Query: 366 LFHKSLNISQHIRRQKNNQTASILSNNRIPLIRSCSSMI*RLQ-----MRSSLFQDPLIS 202 L H+ N S R Q N S + IPLI SCS+ LQ +RSSL +P I+ Sbjct: 3 LLHQLRNPSPPPRFQPNT-FLSTFATTCIPLITSCSTKTHLLQIHARLLRSSLVDNPSIT 61 Query: 201 YAFVSRATLSP-HDLGCSRLVFGQIISPNVFQYDSTL 94 AF+SRA LSP D+ SR VF QI P VF Y++ L Sbjct: 62 TAFLSRAALSPLGDINYSRRVFEQIPKPTVFHYNTML 98 >ref|XP_002282049.1| PREDICTED: pentatricopeptide repeat-containing protein At3g47530 [Vitis vinifera] Length = 643 Score = 53.1 bits (126), Expect(2) = 4e-06 Identities = 40/114 (35%), Positives = 57/114 (50%), Gaps = 6/114 (5%) Frame = -1 Query: 426 ACKTGKSPYLPASN*QSSLFLFHKSLNISQHIRRQKNNQTASILSNNRIPLIRSCSSMI* 247 A T P+L + S+ H+ L H + +++ N I LI+SCS Sbjct: 28 AFSTASLPFLDSEESPSTASENHRRLQHQTHPLPKSRDES----ENQLISLIKSCSKKTH 83 Query: 246 RLQ-----MRSSLFQDPLISYAFVSRATLSP-HDLGCSRLVFGQIISPNVFQYD 103 LQ +R+SL Q+ IS F+SRA LSP D+G S VF QI+ P+ QY+ Sbjct: 84 LLQIHAHIIRTSLIQNHFISLQFLSRAALSPSRDMGYSSQVFSQIMKPSGSQYN 137 Score = 23.9 bits (50), Expect(2) = 4e-06 Identities = 12/26 (46%), Positives = 13/26 (50%) Frame = -3 Query: 94 RACSKGSCPEKSFSLYRHMNGCNVVP 17 RA S PE+ F LYR M V P Sbjct: 141 RAYSMSHSPEQGFYLYREMRRRGVPP 166