BLASTX nr result
ID: Anemarrhena21_contig00027944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00027944 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT22081.1| hypothetical protein F775_05575 [Aegilops tauschii] 61 3e-07 ref|XP_006644734.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 gb|EEE55404.1| hypothetical protein OsJ_03510 [Oryza sativa Japo... 60 4e-07 gb|EEC71511.1| hypothetical protein OsI_03797 [Oryza sativa Indi... 60 4e-07 ref|XP_002458516.1| hypothetical protein SORBIDRAFT_03g035040 [S... 60 4e-07 ref|NP_001044296.1| Os01g0757700 [Oryza sativa Japonica Group] g... 60 4e-07 gb|EMS68583.1| hypothetical protein TRIUR3_10614 [Triticum urartu] 59 1e-06 ref|XP_010671597.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_008655046.1| PREDICTED: EMB1417 isoform X2 [Zea mays] 58 2e-06 ref|NP_001150239.1| EMB1417 [Zea mays] gi|195637738|gb|ACG38337.... 58 2e-06 ref|NP_001140314.1| uncharacterized protein LOC100272359 [Zea ma... 58 2e-06 ref|XP_004970013.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_004970010.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 tpg|DAA57563.1| TPA: hypothetical protein ZEAMMB73_276663 [Zea m... 58 2e-06 ref|XP_008655049.1| PREDICTED: EMB1417 isoform X3 [Zea mays] gi|... 58 2e-06 ref|XP_008655048.1| PREDICTED: EMB1417 isoform X1 [Zea mays] gi|... 58 2e-06 ref|XP_009396197.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_003569848.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_010279053.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 ref|XP_010279052.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >gb|EMT22081.1| hypothetical protein F775_05575 [Aegilops tauschii] Length = 289 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -1 Query: 223 SLFLEVCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 +L +VCG RGPRP+YPRVW+T KRIG V KSQ L+ C Sbjct: 19 NLVAQVCGARGPRPRYPRVWKTDKRIGTVSKSQKLVKC 56 >ref|XP_006644734.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190-like [Oryza brachyantha] Length = 295 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 214 LEVCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 L VCG RGPRP+YPRVW+T+KRIG V KSQ L+ C Sbjct: 29 LVVCGARGPRPRYPRVWKTRKRIGTVSKSQKLVQC 63 >gb|EEE55404.1| hypothetical protein OsJ_03510 [Oryza sativa Japonica Group] Length = 295 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 214 LEVCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 L VCG RGPRP+YPRVW+T+KRIG V KSQ L+ C Sbjct: 29 LVVCGARGPRPRYPRVWKTRKRIGTVSKSQKLVEC 63 >gb|EEC71511.1| hypothetical protein OsI_03797 [Oryza sativa Indica Group] Length = 295 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 214 LEVCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 L VCG RGPRP+YPRVW+T+KRIG V KSQ L+ C Sbjct: 29 LVVCGARGPRPRYPRVWKTRKRIGTVSKSQKLVEC 63 >ref|XP_002458516.1| hypothetical protein SORBIDRAFT_03g035040 [Sorghum bicolor] gi|241930491|gb|EES03636.1| hypothetical protein SORBIDRAFT_03g035040 [Sorghum bicolor] Length = 296 Score = 60.5 bits (145), Expect = 4e-07 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG+RGPRP+YPRVW+TQK+IG + KSQ L+ C Sbjct: 31 VCGVRGPRPRYPRVWKTQKKIGTISKSQKLVEC 63 >ref|NP_001044296.1| Os01g0757700 [Oryza sativa Japonica Group] gi|113533827|dbj|BAF06210.1| Os01g0757700 [Oryza sativa Japonica Group] gi|215734974|dbj|BAG95696.1| unnamed protein product [Oryza sativa Japonica Group] Length = 213 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -1 Query: 214 LEVCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 L VCG RGPRP+YPRVW+T+KRIG V KSQ L+ C Sbjct: 29 LVVCGARGPRPRYPRVWKTRKRIGTVSKSQKLVEC 63 >gb|EMS68583.1| hypothetical protein TRIUR3_10614 [Triticum urartu] Length = 419 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T KRIG V KSQ L+ C Sbjct: 127 VCGARGPRPRYPRVWKTDKRIGTVSKSQKLVKC 159 >ref|XP_010671597.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Beta vulgaris subsp. vulgaris] gi|870865091|gb|KMT16158.1| hypothetical protein BVRB_3g053190 [Beta vulgaris subsp. vulgaris] Length = 303 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/38 (57%), Positives = 31/38 (81%) Frame = -1 Query: 223 SLFLEVCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 S ++ VCG++GPRP+YPRVW+T KRIG + KS+ L+ C Sbjct: 55 SRYVIVCGLKGPRPRYPRVWKTHKRIGTISKSRKLVDC 92 >ref|XP_008655046.1| PREDICTED: EMB1417 isoform X2 [Zea mays] Length = 335 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 63 >ref|NP_001150239.1| EMB1417 [Zea mays] gi|195637738|gb|ACG38337.1| EMB1417 [Zea mays] Length = 296 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 63 >ref|NP_001140314.1| uncharacterized protein LOC100272359 [Zea mays] gi|670383092|ref|XP_008672327.1| PREDICTED: uncharacterized protein LOC100272359 isoform X1 [Zea mays] gi|670383094|ref|XP_008672328.1| PREDICTED: uncharacterized protein LOC100272359 isoform X1 [Zea mays] gi|670383096|ref|XP_008672329.1| PREDICTED: uncharacterized protein LOC100272359 isoform X1 [Zea mays] gi|670383098|ref|XP_008672330.1| PREDICTED: uncharacterized protein LOC100272359 isoform X1 [Zea mays] gi|194698952|gb|ACF83560.1| unknown [Zea mays] gi|224032859|gb|ACN35505.1| unknown [Zea mays] gi|414880433|tpg|DAA57564.1| TPA: hypothetical protein ZEAMMB73_276663 [Zea mays] gi|414880434|tpg|DAA57565.1| TPA: hypothetical protein ZEAMMB73_276663 [Zea mays] gi|414880435|tpg|DAA57566.1| TPA: hypothetical protein ZEAMMB73_276663 [Zea mays] Length = 296 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 63 >ref|XP_004970013.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X1 [Setaria italica] Length = 313 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 34 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 66 >ref|XP_004970010.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Setaria italica] Length = 311 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 32 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 64 >tpg|DAA57563.1| TPA: hypothetical protein ZEAMMB73_276663 [Zea mays] Length = 193 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 63 >ref|XP_008655049.1| PREDICTED: EMB1417 isoform X3 [Zea mays] gi|413952395|gb|AFW85044.1| hypothetical protein ZEAMMB73_708833 [Zea mays] Length = 287 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 63 >ref|XP_008655048.1| PREDICTED: EMB1417 isoform X1 [Zea mays] gi|413952394|gb|AFW85043.1| EMB1417 [Zea mays] Length = 296 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+T+K+IG + KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKTRKKIGTISKSQKLVEC 63 >ref|XP_009396197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190-like [Musa acuminata subsp. malaccensis] Length = 257 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP++PRVW+T+KRIG + KSQ L+ C Sbjct: 29 VCGTRGPRPRFPRVWKTRKRIGTISKSQKLVEC 61 >ref|XP_003569848.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Brachypodium distachyon] gi|721644631|ref|XP_010232346.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Brachypodium distachyon] gi|721644636|ref|XP_010232347.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 [Brachypodium distachyon] Length = 296 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/33 (69%), Positives = 26/33 (78%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VCG RGPRP+YPRVW+ KRIG V KSQ L+ C Sbjct: 31 VCGARGPRPRYPRVWKADKRIGTVSKSQKLVKC 63 >ref|XP_010279053.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X2 [Nelumbo nucifera] Length = 232 Score = 56.6 bits (135), Expect = 6e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VC +GPRP+YPRVW+++KRIG + KSQNL+ C Sbjct: 29 VCAAKGPRPRYPRVWKSRKRIGTISKSQNLVEC 61 >ref|XP_010279052.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21190 isoform X1 [Nelumbo nucifera] Length = 280 Score = 56.6 bits (135), Expect = 6e-06 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -1 Query: 208 VCGMRGPRPKYPRVWRTQKRIGAVCKSQNLIYC 110 VC +GPRP+YPRVW+++KRIG + KSQNL+ C Sbjct: 29 VCAAKGPRPRYPRVWKSRKRIGTISKSQNLVEC 61