BLASTX nr result
ID: Anemarrhena21_contig00027743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00027743 (386 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008776854.1| PREDICTED: uncharacterized protein LOC103696... 69 1e-09 >ref|XP_008776854.1| PREDICTED: uncharacterized protein LOC103696911 [Phoenix dactylifera] Length = 67 Score = 68.9 bits (167), Expect = 1e-09 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = -2 Query: 277 SVLSFFGIKKARVE--DAEVKPRAPRKIRSSDEDRGRRWYAEPDIDRKANEYIIRIHNDM 104 S+L F G KK E D E PR PRK+R SDEDRG WY EPDIDRKA E+I ++H +M Sbjct: 7 SLLGFLGFKKHHHERQDVEEGPRHPRKVRPSDEDRGH-WYGEPDIDRKAKEFIDKVHRNM 65