BLASTX nr result
ID: Anemarrhena21_contig00027605
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00027605 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFG00472.1| conserved hypothetical protein [Listeria monocyto... 62 7e-08 emb|CEH44534.1| hypothetical protein XAC3610_10050001 [Xanthomon... 45 9e-07 emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum... 59 1e-06 emb|CEH53215.1| hypothetical protein XACS582_11310001 [Xanthomon... 45 1e-06 >gb|EFG00472.1| conserved hypothetical protein [Listeria monocytogenes J2818] Length = 110 Score = 62.0 bits (149), Expect(2) = 7e-08 Identities = 28/49 (57%), Positives = 32/49 (65%) Frame = -1 Query: 197 PHYCNCGSFGPPASVTWPSSWTWIDRLASGLFPATVTPV*DSVSLRLPY 51 P N FGPP S+T PSSWTW+D L SGL P T P DS+SLRL + Sbjct: 33 PALFNVRGFGPPVSITLPSSWTWVDHLVSGLRPVTYAPYSDSLSLRLRF 81 Score = 21.2 bits (43), Expect(2) = 7e-08 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = -3 Query: 228 LAFHSYPHLIAALLQL 181 L F YPHLI AL + Sbjct: 23 LEFLRYPHLIPALFNV 38 >emb|CEH44534.1| hypothetical protein XAC3610_10050001 [Xanthomonas citri pv. citri] gi|703423244|emb|CEH63558.1| hypothetical protein XACLG97_9100001 [Xanthomonas citri pv. citri] gi|703430056|emb|CEI15539.1| hypothetical protein XACB302_8740001 [Xanthomonas citri pv. citri] gi|703437873|emb|CEI35905.1| hypothetical protein XACJJ10_1720001 [Xanthomonas citri pv. citri] gi|703445226|emb|CEH45422.1| hypothetical protein XACLD7_12360002 [Xanthomonas citri pv. citri] gi|703447424|emb|CEH54604.1| hypothetical protein XACJK48_7680001 [Xanthomonas citri pv. citri] gi|703456990|emb|CEH43546.1| hypothetical protein XAC3615_11480001 [Xanthomonas citri pv. citri] gi|703458187|emb|CEH65841.1| hypothetical protein XACG102_9020002 [Xanthomonas citri pv. citri] gi|703464589|emb|CEH54703.1| hypothetical protein XACLE3_7360001 [Xanthomonas citri pv. citri] gi|703471602|emb|CEH78138.1| hypothetical protein XAC3612_2290002 [Xanthomonas citri pv. citri] gi|713449143|emb|CEI07008.1| hypothetical protein XACG115_2260002 [Xanthomonas citri pv. citri] gi|713455677|emb|CEI16169.1| hypothetical protein XACLG98_2430001 [Xanthomonas citri pv. citri] gi|713469874|emb|CEH96247.1| hypothetical protein XACG117_2160001 [Xanthomonas citri pv. citri] gi|713475913|emb|CEH96682.1| hypothetical protein XACB100_2230001 [Xanthomonas citri pv. citri] gi|713483752|emb|CEH78239.1| hypothetical protein XACLH37_2340001 [Xanthomonas citri pv. citri] gi|713490579|emb|CEH86566.1| hypothetical protein XAC3607_3090001 [Xanthomonas citri pv. citri] gi|723790528|emb|CEJ25532.1| hypothetical protein XACE116_10060001 [Xanthomonas citri pv. citri] gi|723796379|emb|CEJ20942.1| hypothetical protein XACE116_10060001 [Xanthomonas citri pv. citri] gi|746993133|emb|CEL46621.1| hypothetical protein XAC439_9960001 [Xanthomonas citri pv. citri] gi|747001138|emb|CEL39943.1| hypothetical protein XACJK4_2420001 [Xanthomonas citri pv. citri] gi|747006769|emb|CEL48745.1| hypothetical protein XACJM35_2180001 [Xanthomonas citri pv. citri] gi|747011621|emb|CEL34943.1| hypothetical protein XAC4311_2140001 [Xanthomonas citri pv. citri] Length = 150 Score = 45.4 bits (106), Expect(2) = 9e-07 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 86 PV*DSVSLRLPYSVSLATENNSLTHYTK 3 P+ DSVSLRLPY+V LAT + SLTHYTK Sbjct: 35 PLSDSVSLRLPYTVKLATNSKSLTHYTK 62 Score = 33.9 bits (76), Expect(2) = 9e-07 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -3 Query: 189 LQLWFVRTSSQCYLAFILDMDRSTGFGSIPSD 94 +Q +VR SS CY F L M RS GFGS D Sbjct: 1 MQQTWVRASSTCYGTFTLAMTRSPGFGSTARD 32 >emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] gi|566555979|emb|CDK99198.1| protein of unknown function [Magnetospirillum gryphiswaldense MSR-1 v2] Length = 259 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/73 (43%), Positives = 36/73 (49%) Frame = -1 Query: 221 FTPIHTSSPHYCNCGSFGPPASVTWPSSWTWIDRLASGLFPATVTPV*DSVSLRLPYSVS 42 F P P + N FGPP VT PS+ WID SGL AT P+ Y + Sbjct: 3 FHPYPQIIPDFFNRRGFGPPVGVTPPSTCPWIDHSVSGLMHATRRPIQTRFRCAYTYRLK 62 Query: 41 LATENNSLTHYTK 3 LA NSLTHYTK Sbjct: 63 LAAYTNSLTHYTK 75 >emb|CEH53215.1| hypothetical protein XACS582_11310001 [Xanthomonas citri pv. citri] gi|713462852|emb|CEH94261.1| hypothetical protein XACS581_1990001 [Xanthomonas citri pv. citri] Length = 150 Score = 45.4 bits (106), Expect(2) = 1e-06 Identities = 21/28 (75%), Positives = 24/28 (85%) Frame = -1 Query: 86 PV*DSVSLRLPYSVSLATENNSLTHYTK 3 P+ DSVSLRLPY+V LAT + SLTHYTK Sbjct: 35 PLSDSVSLRLPYTVKLATNSKSLTHYTK 62 Score = 33.1 bits (74), Expect(2) = 1e-06 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = -3 Query: 189 LQLWFVRTSSQCYLAFILDMDRSTGFGSIPSD 94 +Q +VR SS CY F L M RS GFGS D Sbjct: 1 MQQTWVRASSTCYGNFTLAMTRSPGFGSTARD 32