BLASTX nr result
ID: Anemarrhena21_contig00026904
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00026904 (245 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008790178.1| PREDICTED: histone-lysine N-methyltransferas... 57 5e-06 >ref|XP_008790178.1| PREDICTED: histone-lysine N-methyltransferase ASHR3-like [Phoenix dactylifera] Length = 434 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/46 (52%), Positives = 35/46 (76%) Frame = +3 Query: 6 PFQILKRINPNAFMVDLPPNFGISCIFNVEDLIPFRVPFDTPFHIF 143 P++ILKR+ NA++VD+P +FGI+ +FNVEDL+ +R P P H F Sbjct: 3 PYKILKRVGFNAYVVDIPSDFGINSVFNVEDLVAYRGPTTIPEHPF 48