BLASTX nr result
ID: Anemarrhena21_contig00026806
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00026806 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827857.1| PREDICTED: uncharacterized protein LOC105949... 58 2e-06 >ref|XP_012827857.1| PREDICTED: uncharacterized protein LOC105949127 [Erythranthe guttatus] gi|604298847|gb|EYU18817.1| hypothetical protein MIMGU_mgv1a008100mg [Erythranthe guttata] Length = 385 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -2 Query: 149 MGINYHSGLLKNSNGSARLIITTALGVVFGYFLGISIPNFS 27 MG ++ SG+LK SN ARLIITT +GVVFGYF+G+S P+ S Sbjct: 1 MGTSHRSGVLKRSNDGARLIITTIMGVVFGYFIGVSFPSVS 41