BLASTX nr result
ID: Anemarrhena21_contig00024537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00024537 (506 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010242452.1| PREDICTED: 2-alkenal reductase (NADP(+)-depe... 56 8e-06 >ref|XP_010242452.1| PREDICTED: 2-alkenal reductase (NADP(+)-dependent)-like [Nelumbo nucifera] Length = 346 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -1 Query: 434 VLLNTEIPGFIALCGYIA-V*FHAEESIHNLFCFLTKQIGVQGFVEAG*KHL 282 VLLN ++ G IA+CG I+ H +E +HNLFC +TK+I +QGF+E KHL Sbjct: 242 VLLNMKVHGRIAVCGLISQYNLHEQEGVHNLFCVITKRIRMQGFIEPDHKHL 293