BLASTX nr result
ID: Anemarrhena21_contig00024482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00024482 (519 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779346.1| PREDICTED: salutaridine reductase-like [Phoe... 56 8e-06 >ref|XP_008779346.1| PREDICTED: salutaridine reductase-like [Phoenix dactylifera] Length = 175 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 519 TVEEGAKGPVFVALLPDGSPSGLFYEHTKVLSF 421 TVE+GAKGPV +ALLPDGSPSGLFY+ T+ SF Sbjct: 143 TVEQGAKGPVMLALLPDGSPSGLFYDQTRETSF 175