BLASTX nr result
ID: Anemarrhena21_contig00024404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00024404 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010912260.1| PREDICTED: R3H domain-containing protein 1-l... 53 5e-07 >ref|XP_010912260.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis] Length = 474 Score = 52.8 bits (125), Expect(2) = 5e-07 Identities = 29/51 (56%), Positives = 34/51 (66%), Gaps = 1/51 (1%) Frame = -2 Query: 363 KSSNVKSAEERKEEYNKASARIFSSTS-GTTMTKIGANPNS*DSVLSCFFV 214 K++ KS E+RKEEYNKA ARIF+S+S G M KI PN DS CF V Sbjct: 214 KTNLTKSVEQRKEEYNKARARIFNSSSGGVGMAKIEGEPNLQDSFQQCFSV 264 Score = 27.3 bits (59), Expect(2) = 5e-07 Identities = 17/47 (36%), Positives = 26/47 (55%) Frame = -1 Query: 169 NLRRDLSDSSIGGNN*IKIGCRARAFCL*LQSQHRKSIFQDCEVDQR 29 +L R LSDSSIG N + ++ +R +IF+D EVD++ Sbjct: 280 SLGRTLSDSSIGSNRSNRNRTDKEPAVSKYRASNRVAIFRDREVDRK 326