BLASTX nr result
ID: Anemarrhena21_contig00023709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00023709 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006452100.1| hypothetical protein CICLE_v10010285mg, part... 58 2e-06 >ref|XP_006452100.1| hypothetical protein CICLE_v10010285mg, partial [Citrus clementina] gi|557555326|gb|ESR65340.1| hypothetical protein CICLE_v10010285mg, partial [Citrus clementina] Length = 615 Score = 58.2 bits (139), Expect = 2e-06 Identities = 33/73 (45%), Positives = 48/73 (65%), Gaps = 1/73 (1%) Frame = +3 Query: 3 NQATSVVTANSLLNENKWTIRLKHGYLNELIWQGVISVIDVWSLENV-DPLTKGLKRELV 179 ++AT N + N I L+H Y+ +LI GVI+++ V + +N+ DPLTKGL R+LV Sbjct: 41 SEATLSRAYNKVYNGKSRHISLRHEYVKQLIADGVINIVYVKTNKNLADPLTKGLSRDLV 100 Query: 180 ECTSAGMGLKTLY 218 + TS GMGLK L+ Sbjct: 101 KDTSFGMGLKPLH 113