BLASTX nr result
ID: Anemarrhena21_contig00023676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00023676 (488 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009054415.1| ATP synthase CF0 subunit I (chloroplast) [Po... 66 8e-09 gb|AAA84683.1| ATPase subunit I (chloroplast) [Nicotiana tabacum... 63 7e-08 gb|AGJ51243.1| ATP synthase CF0 B subunit (chloroplast) [Solanum... 63 7e-08 gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum]... 61 3e-07 ref|YP_009155414.1| atpF (chloroplast) [Panax quinquefolius] gi|... 56 8e-06 ref|XP_006356779.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase... 56 8e-06 ref|YP_008815190.1| ATP synthase CF0 subunit I (chloroplast) [Ka... 56 8e-06 ref|YP_008815103.1| ATP synthase CF0 subunit I (chloroplast) [Sc... 56 8e-06 ref|YP_008815016.1| ATP synthase CF0 subunit I (chloroplast) [Me... 56 8e-06 ref|YP_008814929.1| ATP synthase CF0 subunit I (chloroplast) [Br... 56 8e-06 >ref|YP_009054415.1| ATP synthase CF0 subunit I (chloroplast) [Populus euphratica] gi|672352134|gb|AIJ19579.1| ATP synthase CF0 subunit I (chloroplast) [Populus euphratica] Length = 215 Score = 66.2 bits (160), Expect = 8e-09 Identities = 35/58 (60%), Positives = 37/58 (63%) Frame = +2 Query: 314 MNRKIHVWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 MNRK HVWFGK SW N RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 54 MNRKTHVWFGKGSWKFCNEWKDNLLSLSDLLDNRKQRILNTIRNSEELRGGAIEQLEK 111 >gb|AAA84683.1| ATPase subunit I (chloroplast) [Nicotiana tabacum] gi|224351|prf||1102209E ORF 5 Length = 162 Score = 63.2 bits (152), Expect = 7e-08 Identities = 34/58 (58%), Positives = 36/58 (62%) Frame = +2 Query: 314 MNRKIHVWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 MNRKIHVWFGK W RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 1 MNRKIHVWFGKGLWNFGKEWKNNLLSLSDLLDNRKQRILNTIRNSEELRGGAIEQLEK 58 >gb|AGJ51243.1| ATP synthase CF0 B subunit (chloroplast) [Solanum carolinense] Length = 162 Score = 63.2 bits (152), Expect = 7e-08 Identities = 34/58 (58%), Positives = 36/58 (62%) Frame = +2 Query: 314 MNRKIHVWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 MNRKIHVWFGK W RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 1 MNRKIHVWFGKGLWNFGKEYKNNLLSLSDLLDNRKQRILNTIRNSEELRGGAIEQLEK 58 >gb|AAA84682.1| unknown protein (chloroplast) [Nicotiana tabacum] gi|224352|prf||1102209F ORF 6 Length = 79 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/69 (47%), Positives = 42/69 (60%) Frame = -1 Query: 392 MKVDYLSINFTTSMISSRTKHESFDSFGSHAPFFFMGIQFPYLF*CNEPILSISVCIQTY 213 MKVDY SI F S+I SRTKHESFDSFGSHA + + + CNEPI S + + Sbjct: 1 MKVDYFSIPFQNSIIPSRTKHESFDSFGSHAQLLKVNSHI-FFYECNEPIFS---SLFIF 56 Query: 212 QNQYKTRIL 186 Q +T ++ Sbjct: 57 QKDIETNVI 65 >ref|YP_009155414.1| atpF (chloroplast) [Panax quinquefolius] gi|506444394|gb|AGM14956.1| ATP synthase CF0 B subunit (chloroplast) [Panax ginseng] gi|506444482|gb|AGM15042.1| ATP synthase CF0 B subunit (chloroplast) [Panax ginseng] gi|506444598|gb|AGM15128.1| ATP synthase CF0 B subunit (chloroplast) [Panax ginseng] gi|545484697|gb|AGW31889.1| ATP synthase CF0 B subunit (chloroplast) [Panax ginseng] gi|723604088|gb|AIX97875.1| AtpF (chloroplast) [Panax ginseng] gi|723604176|gb|AIX97962.1| AtpF (chloroplast) [Panax ginseng] gi|723604260|gb|AIX98045.1| AtpF (chloroplast) [Panax ginseng] gi|723604346|gb|AIX98130.1| AtpF (chloroplast) [Panax ginseng] gi|723604432|gb|AIX98215.1| AtpF (chloroplast) [Panax ginseng] gi|723604518|gb|AIX98300.1| AtpF (chloroplast) [Panax ginseng] gi|723604604|gb|AIX98385.1| AtpF (chloroplast) [Panax ginseng] gi|723604690|gb|AIX98470.1| AtpF (chloroplast) [Panax ginseng] gi|723604776|gb|AIX98555.1| AtpF (chloroplast) [Panax ginseng] gi|744671682|gb|AJC99474.1| atpF (chloroplast) [Panax quinquefolius] gi|744671793|gb|AJC99559.1| atpF (chloroplast) [Panax ginseng] gi|744671901|gb|AJC99644.1| atpF (chloroplast) [Panax ginseng] Length = 209 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +2 Query: 332 VWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 VWFGK SW N RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 54 VWFGKGSWKFLNEWKENLLSLSDLLDNRKQRILNTIRNSEELREGAIEQLEK 105 >ref|XP_006356779.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase subunit b, chloroplastic-like [Solanum tuberosum] Length = 197 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/54 (55%), Positives = 33/54 (61%) Frame = +2 Query: 326 IHVWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 IHVWFGK W +KQRIL+TIRNSEELRRGAIEQLE+ Sbjct: 40 IHVWFGKGLWNFGKEWKNNLLSLSDLLDNQKQRILNTIRNSEELRRGAIEQLEK 93 >ref|YP_008815190.1| ATP synthase CF0 subunit I (chloroplast) [Kalopanax septemlobus] gi|458599598|gb|AGG39290.1| ATP synthase CF0 subunit I (chloroplast) [Kalopanax septemlobus] Length = 209 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +2 Query: 332 VWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 VWFGK SW N RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 54 VWFGKGSWKFLNEWKENLLSLSDLLDNRKQRILNTIRNSEELREGAIEQLEK 105 >ref|YP_008815103.1| ATP synthase CF0 subunit I (chloroplast) [Schefflera delavayi] gi|458599510|gb|AGG39203.1| ATP synthase CF0 subunit I (chloroplast) [Schefflera delavayi] Length = 209 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +2 Query: 332 VWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 VWFGK SW N RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 54 VWFGKGSWKFLNEWKENLLSLSDLLDNRKQRILNTIRNSEELREGAIEQLEK 105 >ref|YP_008815016.1| ATP synthase CF0 subunit I (chloroplast) [Metapanax delavayi] gi|458599357|gb|AGG39116.1| ATP synthase CF0 subunit I (chloroplast) [Metapanax delavayi] Length = 209 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +2 Query: 332 VWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 VWFGK SW N RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 54 VWFGKGSWKFLNEWKENLLSLSDLLDNRKQRILNTIRNSEELREGAIEQLEK 105 >ref|YP_008814929.1| ATP synthase CF0 subunit I (chloroplast) [Brassaiopsis hainla] gi|458599178|gb|AGG39029.1| ATP synthase CF0 subunit I (chloroplast) [Brassaiopsis hainla] Length = 209 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +2 Query: 332 VWFGKRSWML*N*CXXXXXXXXXXXXXRKQRILSTIRNSEELRRGAIEQLER 487 VWFGK SW N RKQRIL+TIRNSEELR GAIEQLE+ Sbjct: 54 VWFGKGSWKFLNEWKENLLSLSDLLDNRKQRILNTIRNSEELREGAIEQLEK 105