BLASTX nr result
ID: Anemarrhena21_contig00023546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00023546 (204 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070233.1| PREDICTED: type I inositol 1,4,5-trisphospha... 68 2e-09 ref|XP_009418881.1| PREDICTED: type I inositol 1,4,5-trisphospha... 67 4e-09 emb|CDP12961.1| unnamed protein product [Coffea canephora] 67 5e-09 gb|KHN42625.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase... 67 6e-09 ref|XP_010559289.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_010559288.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_010559287.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_008788689.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_008788688.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_008788687.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_008788686.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 8e-09 ref|XP_009392785.1| PREDICTED: type I inositol 1,4,5-trisphospha... 66 1e-08 ref|XP_012857317.1| PREDICTED: type I inositol 1,4,5-trisphospha... 65 1e-08 ref|XP_012857308.1| PREDICTED: type I inositol 1,4,5-trisphospha... 65 1e-08 ref|XP_009136893.1| PREDICTED: type I inositol 1,4,5-trisphospha... 65 1e-08 gb|EYU44098.1| hypothetical protein MIMGU_mgv1a002890mg [Erythra... 65 1e-08 ref|XP_012475732.1| PREDICTED: type I inositol 1,4,5-trisphospha... 65 2e-08 ref|XP_012475735.1| PREDICTED: type I inositol 1,4,5-trisphospha... 65 2e-08 gb|KHG24158.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase... 65 2e-08 ref|XP_007039571.1| Type I inositol polyphosphate 5-phosphatase,... 65 2e-08 >ref|XP_011070233.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X1 [Sesamum indicum] Length = 624 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+EPFWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MKARRGKRSEPFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >ref|XP_009418881.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Musa acuminata subsp. malaccensis] Length = 597 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 M++ +R+E FWP IV+RKWLNIKPKVHEFSEDEVDTE Sbjct: 1 MRTRKGRRSESFWPSIVMRKWLNIKPKVHEFSEDEVDTE 39 >emb|CDP12961.1| unnamed protein product [Coffea canephora] Length = 613 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+ PFWP IV++KWLNIKPK H+FSEDEVDTE Sbjct: 1 MKTRRAKRSPPFWPSIVMKKWLNIKPKAHDFSEDEVDTE 39 >gb|KHN42625.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 [Glycine soja] Length = 658 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -2 Query: 125 QAMKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 Q MK+ KR+E FWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 61 QTMKARRGKRSEAFWPSIVMKKWLNIKPKVNDFSEDEVDTE 101 >ref|XP_010559289.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X3 [Tarenaya hassleriana] Length = 536 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 M++ KR EPFWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MRTRRGKRPEPFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >ref|XP_010559288.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X2 [Tarenaya hassleriana] Length = 549 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 M++ KR EPFWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MRTRRGKRPEPFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >ref|XP_010559287.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X1 [Tarenaya hassleriana] Length = 628 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 M++ KR EPFWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MRTRRGKRPEPFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >ref|XP_008788689.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X4 [Phoenix dactylifera] Length = 507 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP +V+RKWLNIKPKV+EFSEDEVDTE Sbjct: 1 MKTRKGKRSESFWPSMVMRKWLNIKPKVYEFSEDEVDTE 39 >ref|XP_008788688.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X3 [Phoenix dactylifera] Length = 513 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP +V+RKWLNIKPKV+EFSEDEVDTE Sbjct: 1 MKTRKGKRSESFWPSMVMRKWLNIKPKVYEFSEDEVDTE 39 >ref|XP_008788687.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X2 [Phoenix dactylifera] Length = 594 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP +V+RKWLNIKPKV+EFSEDEVDTE Sbjct: 1 MKTRKGKRSESFWPSMVMRKWLNIKPKVYEFSEDEVDTE 39 >ref|XP_008788686.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X1 [Phoenix dactylifera] Length = 599 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP +V+RKWLNIKPKV+EFSEDEVDTE Sbjct: 1 MKTRKGKRSESFWPSMVMRKWLNIKPKVYEFSEDEVDTE 39 >ref|XP_009392785.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Musa acuminata subsp. malaccensis] Length = 546 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 M++ +R+E FWP IV+RKWLNIKPKVHEFSEDE DTE Sbjct: 1 MRTRKGRRSESFWPSIVMRKWLNIKPKVHEFSEDEADTE 39 >ref|XP_012857317.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X2 [Erythranthe guttatus] Length = 606 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+EPFWP IV++KWLNIKPKV++FSEDE DTE Sbjct: 1 MKARRGKRSEPFWPSIVMKKWLNIKPKVYDFSEDEGDTE 39 >ref|XP_012857308.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X1 [Erythranthe guttatus] Length = 610 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+EPFWP IV++KWLNIKPKV++FSEDE DTE Sbjct: 1 MKARRGKRSEPFWPSIVMKKWLNIKPKVYDFSEDEGDTE 39 >ref|XP_009136893.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 isoform X2 [Brassica rapa] Length = 640 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KRTE FWP IV+ KWLNIKPKV++FSEDEVDTE Sbjct: 1 MKTRRGKRTERFWPSIVMNKWLNIKPKVYDFSEDEVDTE 39 >gb|EYU44098.1| hypothetical protein MIMGU_mgv1a002890mg [Erythranthe guttata] Length = 628 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+EPFWP IV++KWLNIKPKV++FSEDE DTE Sbjct: 1 MKARRGKRSEPFWPSIVMKKWLNIKPKVYDFSEDEGDTE 39 >ref|XP_012475732.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] gi|823151806|ref|XP_012475733.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] gi|823151808|ref|XP_012475734.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] Length = 633 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MKTRRGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >ref|XP_012475735.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X2 [Gossypium raimondii] gi|763758036|gb|KJB25367.1| hypothetical protein B456_004G188100 [Gossypium raimondii] gi|763758037|gb|KJB25368.1| hypothetical protein B456_004G188100 [Gossypium raimondii] gi|763758038|gb|KJB25369.1| hypothetical protein B456_004G188100 [Gossypium raimondii] gi|763758039|gb|KJB25370.1| hypothetical protein B456_004G188100 [Gossypium raimondii] gi|763758040|gb|KJB25371.1| hypothetical protein B456_004G188100 [Gossypium raimondii] Length = 628 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MKTRRGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >gb|KHG24158.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 -like protein [Gossypium arboreum] Length = 611 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MKTRRGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39 >ref|XP_007039571.1| Type I inositol polyphosphate 5-phosphatase, putative isoform 1 [Theobroma cacao] gi|590675870|ref|XP_007039572.1| Type I inositol polyphosphate 5-phosphatase, putative isoform 1 [Theobroma cacao] gi|508776816|gb|EOY24072.1| Type I inositol polyphosphate 5-phosphatase, putative isoform 1 [Theobroma cacao] gi|508776817|gb|EOY24073.1| Type I inositol polyphosphate 5-phosphatase, putative isoform 1 [Theobroma cacao] Length = 633 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 119 MKSSNRKRTEPFWPFIVVRKWLNIKPKVHEFSEDEVDTE 3 MK+ KR+E FWP IV++KWLNIKPKV++FSEDEVDTE Sbjct: 1 MKTRRGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDTE 39