BLASTX nr result
ID: Anemarrhena21_contig00023396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00023396 (261 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX93559.1| ATP synthase beta chain (chloroplast) [Anemarrhen... 59 2e-06 emb|CAD10752.1| ATP synthase, beta subunit [Anemarrhena asphodel... 57 4e-06 gb|AFE62999.1| ATP synthase beta subunit, partial [Symphionema m... 57 6e-06 >gb|AEX93559.1| ATP synthase beta chain (chloroplast) [Anemarrhena asphodeloides] Length = 495 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -2 Query: 92 MKINPTTSSPAVSALEEKTLGRIAQIIGPV 3 MKINPTTSSPAVSALEEK LGRIAQIIGPV Sbjct: 1 MKINPTTSSPAVSALEEKNLGRIAQIIGPV 30 >emb|CAD10752.1| ATP synthase, beta subunit [Anemarrhena asphodeloides] Length = 493 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 92 MKINPTTSSPAVSALEEKTLGRIAQIIGPV 3 M+INPTTSSPAVSALEEK LGRIAQIIGPV Sbjct: 1 MRINPTTSSPAVSALEEKNLGRIAQIIGPV 30 >gb|AFE62999.1| ATP synthase beta subunit, partial [Symphionema montanum] Length = 480 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -2 Query: 92 MKINPTTSSPAVSALEEKTLGRIAQIIGPV 3 M+INPTTS+P VSALEEKTLGRIAQIIGPV Sbjct: 1 MRINPTTSAPGVSALEEKTLGRIAQIIGPV 30