BLASTX nr result
ID: Anemarrhena21_contig00022918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022918 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008775962.1| PREDICTED: uncharacterized protein LOC103696... 58 2e-06 >ref|XP_008775962.1| PREDICTED: uncharacterized protein LOC103696204 [Phoenix dactylifera] Length = 756 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/86 (39%), Positives = 51/86 (59%) Frame = -1 Query: 258 TPALISLRRVSSQKNTGNKIVRSVDLSKLREDPVLKSSRTSISTKSHVGRDTASLKLIKY 79 T IS ++ Q+N NK ++S SK+ E VLK + S+ TKS V R + +KL KY Sbjct: 445 TSPSISTTGLTGQRNLENKSIKSPGQSKIGEGKVLKPPKASVLTKSPVNR-VSIMKLKKY 503 Query: 78 QSLRSSSPAKIQVKVGKLEHTNEKVK 1 +++ SS K + KVGK++ EK+K Sbjct: 504 GNMKPSSLVKTEAKVGKVDSNAEKIK 529