BLASTX nr result
ID: Anemarrhena21_contig00022784
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022784 (264 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN05055.1| hypothetical protein AMTR_s00053p00096150 [Ambore... 58 3e-06 >gb|ERN05055.1| hypothetical protein AMTR_s00053p00096150 [Amborella trichopoda] Length = 51 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/47 (57%), Positives = 33/47 (70%) Frame = -3 Query: 253 MPKSETQGRERKEQLPPGYPNENHPPAKNKCCPPRSTKKGEKGFIEG 113 MPK E Q +ERK+Q PPGYP + P K+KC P KKG++GFIEG Sbjct: 1 MPKFENQVKERKQQPPPGYPQGSPPQVKSKC--PHVRKKGDRGFIEG 45