BLASTX nr result
ID: Anemarrhena21_contig00022484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022484 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008801685.1| PREDICTED: LOW QUALITY PROTEIN: L-type lecti... 66 1e-08 ref|XP_006381201.1| hypothetical protein POPTR_0006s08870g, part... 65 1e-08 ref|XP_006381203.1| hypothetical protein POPTR_0006s08890g [Popu... 65 2e-08 ref|XP_011010880.1| PREDICTED: L-type lectin-domain containing r... 64 5e-08 ref|XP_010943349.1| PREDICTED: L-type lectin-domain containing r... 64 5e-08 ref|XP_002534539.1| kinase, putative [Ricinus communis] gi|22352... 64 5e-08 ref|XP_002309078.1| hypothetical protein POPTR_0006s08970g [Popu... 64 5e-08 ref|XP_009417023.1| PREDICTED: L-type lectin-domain containing r... 63 9e-08 ref|XP_006387255.1| hypothetical protein POPTR_1407s00200g, part... 63 9e-08 ref|XP_007208273.1| hypothetical protein PRUPE_ppa015709mg [Prun... 62 1e-07 ref|XP_008780293.1| PREDICTED: L-type lectin-domain containing r... 62 1e-07 ref|XP_008240576.1| PREDICTED: L-type lectin-domain containing r... 62 1e-07 ref|XP_008240448.1| PREDICTED: L-type lectin-domain containing r... 62 1e-07 ref|XP_010240174.1| PREDICTED: L-type lectin-domain containing r... 62 1e-07 ref|XP_010028192.1| PREDICTED: L-type lectin-domain containing r... 61 3e-07 ref|XP_010028188.1| PREDICTED: L-type lectin-domain containing r... 61 3e-07 ref|XP_006381205.1| hypothetical protein POPTR_0006s089001g, par... 61 3e-07 ref|XP_010040833.1| PREDICTED: L-type lectin-domain containing r... 61 3e-07 ref|XP_010262576.1| PREDICTED: L-type lectin-domain containing r... 60 4e-07 ref|XP_010040815.1| PREDICTED: L-type lectin-domain containing r... 60 4e-07 >ref|XP_008801685.1| PREDICTED: LOW QUALITY PROTEIN: L-type lectin-domain containing receptor kinase IV.1-like [Phoenix dactylifera] Length = 613 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 ++ DD FTFNGF+ NL+LDG+A + SNGLL LTN T MKGHAF+P Sbjct: 20 STSDDGFTFNGFTGANLTLDGIASITSNGLLMLTNKTRQMKGHAFHP 66 >ref|XP_006381201.1| hypothetical protein POPTR_0006s08870g, partial [Populus trichocarpa] gi|550335812|gb|ERP58998.1| hypothetical protein POPTR_0006s08870g, partial [Populus trichocarpa] Length = 656 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/47 (70%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 +S D NFTF+GF STNLSLDG+A + SNGLL+LTN T H GHAFYP Sbjct: 6 DSQDLNFTFSGFQSTNLSLDGLAELTSNGLLRLTNETYHRTGHAFYP 52 >ref|XP_006381203.1| hypothetical protein POPTR_0006s08890g [Populus trichocarpa] gi|550335814|gb|ERP59000.1| hypothetical protein POPTR_0006s08890g [Populus trichocarpa] Length = 546 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/46 (71%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +1 Query: 211 SGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 S D NFTF+GF STNLSLDG+A + SNGLL+LTN T H GHAFYP Sbjct: 20 SQDFNFTFSGFRSTNLSLDGLAELTSNGLLRLTNETYHRTGHAFYP 65 >ref|XP_011010880.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Populus euphratica] Length = 668 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +1 Query: 211 SGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 S D NFTF+GF STNLSLDG+A + SNGLL+LTN+T H HAFYP Sbjct: 20 SQDLNFTFSGFRSTNLSLDGLAELTSNGLLRLTNVTYHRTSHAFYP 65 >ref|XP_010943349.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Elaeis guineensis] Length = 679 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/47 (61%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 ++ DD+ TFNGFS NL+LDG+A + SNGLL LTN T MKGH F+P Sbjct: 36 STSDDDLTFNGFSGANLTLDGIASITSNGLLMLTNKTKQMKGHGFHP 82 >ref|XP_002534539.1| kinase, putative [Ricinus communis] gi|223525084|gb|EEF27843.1| kinase, putative [Ricinus communis] Length = 669 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/47 (65%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 +S D +FT+NGF S NLSLDG+A + SNGLL+LTN T KGHAFYP Sbjct: 17 DSQDLSFTYNGFRSANLSLDGIAAITSNGLLRLTNHTKQQKGHAFYP 63 >ref|XP_002309078.1| hypothetical protein POPTR_0006s08970g [Populus trichocarpa] gi|222855054|gb|EEE92601.1| hypothetical protein POPTR_0006s08970g [Populus trichocarpa] Length = 534 Score = 63.5 bits (153), Expect = 5e-08 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = +1 Query: 211 SGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHMK-GHAFYP 345 S D NFTF+GF STNLSLDG+A + SNGLL+LTN T+ + GHAFYP Sbjct: 20 SQDLNFTFSGFRSTNLSLDGLAELTSNGLLRLTNKTYNRMGHAFYP 65 >ref|XP_009417023.1| PREDICTED: L-type lectin-domain containing receptor kinase V.9-like [Musa acuminata subsp. malaccensis] Length = 343 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/47 (63%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 + G+D+FTFNGF NL+ DGVA V S+GLL+LTNM+ KGHAFYP Sbjct: 25 SGGNDSFTFNGFGRLNLTFDGVANVTSDGLLKLTNMSKQSKGHAFYP 71 >ref|XP_006387255.1| hypothetical protein POPTR_1407s00200g, partial [Populus trichocarpa] gi|550306069|gb|ERP46169.1| hypothetical protein POPTR_1407s00200g, partial [Populus trichocarpa] Length = 479 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +1 Query: 211 SGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHMK-GHAFYP 345 S D NFTF+GF STNLSLDG+A + SNGLL+LTN T + GHAFYP Sbjct: 20 SQDLNFTFSGFRSTNLSLDGLAELTSNGLLRLTNETKQRTGHAFYP 65 >ref|XP_007208273.1| hypothetical protein PRUPE_ppa015709mg [Prunus persica] gi|462403915|gb|EMJ09472.1| hypothetical protein PRUPE_ppa015709mg [Prunus persica] Length = 659 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHMKGHAFYP 345 D NFT+NGF S NLSLDGVA + SNGLL+LTN T + GHAFYP Sbjct: 18 DLNFTYNGFLSANLSLDGVAHITSNGLLKLTNDTGL-GHAFYP 59 >ref|XP_008780293.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like, partial [Phoenix dactylifera] Length = 298 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/47 (59%), Positives = 36/47 (76%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 ++ DD FTFNGF+ NL+LDG+A + SNGLL LTN T + GHAF+P Sbjct: 20 STSDDGFTFNGFTGANLNLDGIASITSNGLLMLTNKTKEVTGHAFHP 66 >ref|XP_008240576.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Prunus mume] Length = 664 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHMKGHAFYP 345 D NFT+NGF S NLSLDGVA V SNGLL+LTN T + GHAFYP Sbjct: 18 DLNFTYNGFLSANLSLDGVAQVTSNGLLKLTNDTGL-GHAFYP 59 >ref|XP_008240448.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Prunus mume] Length = 659 Score = 62.0 bits (149), Expect = 1e-07 Identities = 32/43 (74%), Positives = 35/43 (81%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHMKGHAFYP 345 D NFT+NGF S NLSLDGVA V SNGLL+LTN T + GHAFYP Sbjct: 18 DLNFTYNGFLSANLSLDGVAQVTSNGLLKLTNDTAL-GHAFYP 59 >ref|XP_010240174.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Brachypodium distachyon] Length = 678 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +1 Query: 211 SGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 S D+ F FNGF+ NLS+DG+A V NGLLQLTN T +KGHAF+P Sbjct: 28 SADEQFVFNGFTGANLSMDGMARVTPNGLLQLTNATSQLKGHAFFP 73 >ref|XP_010028192.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Eucalyptus grandis] gi|629088632|gb|KCW54885.1| hypothetical protein EUGRSUZ_I00850 [Eucalyptus grandis] Length = 668 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 + NF +NGF S NLSLDG+A V SNGLL+LTN T KGHAF+P Sbjct: 20 ETNFVYNGFRSANLSLDGIAAVTSNGLLKLTNFTKQQKGHAFHP 63 >ref|XP_010028188.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Eucalyptus grandis] gi|629088623|gb|KCW54876.1| hypothetical protein EUGRSUZ_I00837 [Eucalyptus grandis] Length = 668 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 + NF +NGF S NLSLDG+A V SNGLL+LTN T KGHAF+P Sbjct: 20 ETNFVYNGFRSANLSLDGIAAVTSNGLLKLTNFTKQQKGHAFHP 63 >ref|XP_006381205.1| hypothetical protein POPTR_0006s089001g, partial [Populus trichocarpa] gi|550335816|gb|ERP59002.1| hypothetical protein POPTR_0006s089001g, partial [Populus trichocarpa] Length = 620 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/46 (67%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +1 Query: 211 SGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHMK-GHAFYP 345 S D NFTF+GF STNLSLDG+A + SNGLL+LTN T ++ HAFYP Sbjct: 6 SQDLNFTFSGFRSTNLSLDGLAELTSNGLLRLTNETKLRTSHAFYP 51 >ref|XP_010040833.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Eucalyptus grandis] gi|629077089|gb|KCW44881.1| hypothetical protein EUGRSUZ_L01538 [Eucalyptus grandis] Length = 667 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 + NF +NGF S NLSLDG+A V SNGLL+LTN T KGHAF+P Sbjct: 20 ETNFVYNGFRSANLSLDGIAAVTSNGLLKLTNATKQQKGHAFHP 63 >ref|XP_010262576.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Nelumbo nucifera] Length = 667 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 1/47 (2%) Frame = +1 Query: 208 NSGDDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMT-HMKGHAFYP 345 +S DD FT+NGF NLSLDG+A + NGLL +TN T KGHAFYP Sbjct: 18 DSKDDGFTYNGFRGANLSLDGLAQITPNGLLMITNSTSDEKGHAFYP 64 >ref|XP_010040815.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.1-like [Eucalyptus grandis] Length = 625 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/44 (65%), Positives = 35/44 (79%), Gaps = 1/44 (2%) Frame = +1 Query: 217 DDNFTFNGFSSTNLSLDGVAFVASNGLLQLTNMTHM-KGHAFYP 345 + NF +NGF S NLSLDG+A V SNGLL+LTN T + KGHAF+P Sbjct: 20 ETNFVYNGFRSANLSLDGIAAVTSNGLLKLTNDTKLQKGHAFHP 63