BLASTX nr result
ID: Anemarrhena21_contig00022435
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022435 (216 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010246627.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 60 7e-07 ref|XP_008800259.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin ca... 59 1e-06 ref|XP_007131452.1| hypothetical protein PHAVU_011G014600g [Phas... 59 2e-06 gb|AFW90523.1| ubiquitin carboxyl-terminal hydrolase 24-like pro... 59 2e-06 gb|KHN32381.1| Ubiquitin carboxyl-terminal hydrolase 24 [Glycine... 57 4e-06 ref|XP_003539934.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 4e-06 ref|XP_002513114.1| conserved hypothetical protein [Ricinus comm... 57 5e-06 gb|KHN11726.1| Ubiquitin carboxyl-terminal hydrolase 24 [Glycine... 57 6e-06 ref|XP_003534373.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 57 6e-06 ref|XP_009405463.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 56 8e-06 emb|CDY23262.1| BnaA08g12840D [Brassica napus] 56 8e-06 ref|XP_007008788.1| Ubiquitin-specific protease 24 isoform 4 [Th... 56 8e-06 ref|XP_007008787.1| Ubiquitin-specific protease 24 isoform 3 [Th... 56 8e-06 ref|XP_007008785.1| Ubiquitin-specific protease 24 isoform 1 [Th... 56 8e-06 ref|XP_004506356.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 56 8e-06 >ref|XP_010246627.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Nelumbo nucifera] Length = 545 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLRYDDASV+AVG NKVLHDQAYVLFY++V Sbjct: 516 WLRYDDASVTAVGVNKVLHDQAYVLFYKQV 545 >ref|XP_008800259.1| PREDICTED: LOW QUALITY PROTEIN: ubiquitin carboxyl-terminal hydrolase 24-like [Phoenix dactylifera] Length = 541 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DDASV+AVGT KVLHDQAYVLFYR+V Sbjct: 512 WLRFDDASVAAVGTKKVLHDQAYVLFYRQV 541 >ref|XP_007131452.1| hypothetical protein PHAVU_011G014600g [Phaseolus vulgaris] gi|593102125|ref|XP_007131453.1| hypothetical protein PHAVU_011G014600g [Phaseolus vulgaris] gi|561004452|gb|ESW03446.1| hypothetical protein PHAVU_011G014600g [Phaseolus vulgaris] gi|561004453|gb|ESW03447.1| hypothetical protein PHAVU_011G014600g [Phaseolus vulgaris] Length = 530 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DDASV A+GTNKVLHDQAYVLFYR++ Sbjct: 501 WLRFDDASVFAIGTNKVLHDQAYVLFYRQL 530 >gb|AFW90523.1| ubiquitin carboxyl-terminal hydrolase 24-like protein [Phaseolus vulgaris] Length = 530 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DDASV A+GTNKVLHDQAYVLFYR++ Sbjct: 501 WLRFDDASVFAIGTNKVLHDQAYVLFYRQL 530 >gb|KHN32381.1| Ubiquitin carboxyl-terminal hydrolase 24 [Glycine soja] Length = 530 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DD SV A+GTNKVLHDQAYVLFYR++ Sbjct: 501 WLRFDDQSVFAIGTNKVLHDQAYVLFYRQI 530 >ref|XP_003539934.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Glycine max] Length = 530 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DD SV A+GTNKVLHDQAYVLFYR++ Sbjct: 501 WLRFDDQSVFAIGTNKVLHDQAYVLFYRQI 530 >ref|XP_002513114.1| conserved hypothetical protein [Ricinus communis] gi|223548125|gb|EEF49617.1| conserved hypothetical protein [Ricinus communis] Length = 605 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WL +DDASV+A+GT+KVLHDQAYVLFYR+V Sbjct: 576 WLHFDDASVTAIGTSKVLHDQAYVLFYRQV 605 >gb|KHN11726.1| Ubiquitin carboxyl-terminal hydrolase 24 [Glycine soja] Length = 496 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DD SV A+GTNKVLHDQAYVLFYR++ Sbjct: 467 WLRFDDQSVFAIGTNKVLHDQAYVLFYRQM 496 >ref|XP_003534373.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Glycine max] Length = 532 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DD SV A+GTNKVLHDQAYVLFYR++ Sbjct: 503 WLRFDDQSVFAIGTNKVLHDQAYVLFYRQM 532 >ref|XP_009405463.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24-like [Musa acuminata subsp. malaccensis] Length = 537 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLRYDDA+V+AV TNKVLHDQAYVLFY+++ Sbjct: 508 WLRYDDATVTAVTTNKVLHDQAYVLFYKQM 537 >emb|CDY23262.1| BnaA08g12840D [Brassica napus] Length = 547 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DDASV+AVGT +VLHDQAYVLFY++V Sbjct: 518 WLRFDDASVTAVGTKQVLHDQAYVLFYKQV 547 >ref|XP_007008788.1| Ubiquitin-specific protease 24 isoform 4 [Theobroma cacao] gi|508725701|gb|EOY17598.1| Ubiquitin-specific protease 24 isoform 4 [Theobroma cacao] Length = 549 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRR 130 WLR+DDASV+A+GT+KVLHDQAYVLFY++ Sbjct: 520 WLRFDDASVTAIGTSKVLHDQAYVLFYKQ 548 >ref|XP_007008787.1| Ubiquitin-specific protease 24 isoform 3 [Theobroma cacao] gi|508725700|gb|EOY17597.1| Ubiquitin-specific protease 24 isoform 3 [Theobroma cacao] Length = 549 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRR 130 WLR+DDASV+A+GT+KVLHDQAYVLFY++ Sbjct: 520 WLRFDDASVTAIGTSKVLHDQAYVLFYKQ 548 >ref|XP_007008785.1| Ubiquitin-specific protease 24 isoform 1 [Theobroma cacao] gi|508725698|gb|EOY17595.1| Ubiquitin-specific protease 24 isoform 1 [Theobroma cacao] Length = 548 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRR 130 WLR+DDASV+A+GT+KVLHDQAYVLFY++ Sbjct: 519 WLRFDDASVTAIGTSKVLHDQAYVLFYKQ 547 >ref|XP_004506356.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24 [Cicer arietinum] Length = 535 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 216 WLRYDDASVSAVGTNKVLHDQAYVLFYRRV 127 WLR+DDASV A+G NKVLHDQAYVLFY+++ Sbjct: 506 WLRFDDASVFAIGANKVLHDQAYVLFYKQI 535