BLASTX nr result
ID: Anemarrhena21_contig00022430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022430 (204 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010909968.1| PREDICTED: pentatricopeptide repeat-containi... 94 3e-17 ref|XP_008777603.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 ref|XP_010245155.1| PREDICTED: pentatricopeptide repeat-containi... 89 1e-15 ref|XP_010249893.1| PREDICTED: pentatricopeptide repeat-containi... 87 3e-15 ref|XP_009380612.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 emb|CBI22025.3| unnamed protein product [Vitis vinifera] 84 4e-14 ref|XP_002277494.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_011466975.1| PREDICTED: pentatricopeptide repeat-containi... 83 8e-14 tpg|DAA50652.1| TPA: hypothetical protein ZEAMMB73_776700 [Zea m... 82 1e-13 ref|XP_008228981.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 82 2e-13 ref|XP_006650794.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_004970613.1| PREDICTED: pentatricopeptide repeat-containi... 82 2e-13 ref|XP_006348896.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_007216453.1| hypothetical protein PRUPE_ppa023564mg [Prun... 81 2e-13 ref|XP_002464150.1| hypothetical protein SORBIDRAFT_01g013130 [S... 80 4e-13 ref|XP_004243267.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 emb|CDM83637.1| unnamed protein product [Triticum aestivum] 80 7e-13 gb|EEE60175.1| hypothetical protein OsJ_13106 [Oryza sativa Japo... 80 7e-13 gb|EEC76412.1| hypothetical protein OsI_14066 [Oryza sativa Indi... 80 7e-13 gb|AAO60036.1| hypothetical protein [Oryza sativa Japonica Group] 80 7e-13 >ref|XP_010909968.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Elaeis guineensis] Length = 670 Score = 94.4 bits (233), Expect = 3e-17 Identities = 47/67 (70%), Positives = 54/67 (80%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HA IITSGAS+DRFT+N+LLHMYSKLGQLQ AL +F MPR+NVMS NIL+GG I N D Sbjct: 88 HALIITSGASNDRFTANHLLHMYSKLGQLQTALVLFGAMPRRNVMSYNILLGGLIQNGDP 147 Query: 23 QTARRIF 3 + AR F Sbjct: 148 RAARDFF 154 >ref|XP_008777603.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Phoenix dactylifera] Length = 671 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/67 (65%), Positives = 54/67 (80%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HA IITSGAS+DRFT+N+LLHMYSK+G LQ AL +F MPR+NVMS NIL+GG + N D Sbjct: 89 HALIITSGASNDRFTANHLLHMYSKIGLLQTALSLFGAMPRRNVMSYNILLGGLLQNGDL 148 Query: 23 QTARRIF 3 + AR +F Sbjct: 149 RDARELF 155 >ref|XP_010245155.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] Length = 622 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/67 (61%), Positives = 53/67 (79%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ IITSG SSD+F SN+LL+MYSK G+L + +F MPRKN+M+SNILIGGFI N D Sbjct: 40 HSLIITSGCSSDKFISNHLLNMYSKFGELHTTVALFNVMPRKNIMTSNILIGGFIQNGDL 99 Query: 23 QTARRIF 3 +TA ++F Sbjct: 100 ETAWKLF 106 >ref|XP_010249893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980713|ref|XP_010249894.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980717|ref|XP_010249895.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980721|ref|XP_010249896.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980724|ref|XP_010249897.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980728|ref|XP_010249898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980731|ref|XP_010249899.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980734|ref|XP_010249900.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980737|ref|XP_010249901.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] gi|719980740|ref|XP_010249902.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Nelumbo nucifera] Length = 679 Score = 87.4 bits (215), Expect = 3e-15 Identities = 41/67 (61%), Positives = 53/67 (79%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ IITSG SSD+F SN+LL+MYSK G+L A+ +F MPRKN+M+SNILIGGFI + D Sbjct: 97 HSLIITSGCSSDKFISNHLLNMYSKFGELHTAVALFNLMPRKNIMTSNILIGGFIQSGDL 156 Query: 23 QTARRIF 3 TA ++F Sbjct: 157 VTAWKLF 163 >ref|XP_009380612.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Musa acuminata subsp. malaccensis] Length = 660 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/67 (59%), Positives = 50/67 (74%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HA I+ +GA+S RFT+N+LLHMYSKLGQ A +F MPR+NVMS NIL+GG I N D Sbjct: 77 HALIVAAGAASHRFTANHLLHMYSKLGQGNAARAVFDAMPRRNVMSFNILVGGLIQNGDI 136 Query: 23 QTARRIF 3 AR++F Sbjct: 137 LAARKLF 143 >emb|CBI22025.3| unnamed protein product [Vitis vinifera] Length = 489 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/67 (58%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ IITSG SSD+F SN+LL++YSK GQL A+ +F MPRKN+MS NILI G+ + D+ Sbjct: 75 HSLIITSGCSSDKFISNHLLNLYSKCGQLDTAITLFGVMPRKNIMSCNILINGYFRSGDW 134 Query: 23 QTARRIF 3 TAR++F Sbjct: 135 VTARKMF 141 >ref|XP_002277494.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Vitis vinifera] Length = 657 Score = 84.0 bits (206), Expect = 4e-14 Identities = 39/67 (58%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ IITSG SSD+F SN+LL++YSK GQL A+ +F MPRKN+MS NILI G+ + D+ Sbjct: 75 HSLIITSGCSSDKFISNHLLNLYSKCGQLDTAITLFGVMPRKNIMSCNILINGYFRSGDW 134 Query: 23 QTARRIF 3 TAR++F Sbjct: 135 VTARKMF 141 >ref|XP_011466975.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Fragaria vesca subsp. vesca] gi|764605409|ref|XP_011466976.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Fragaria vesca subsp. vesca] Length = 641 Score = 82.8 bits (203), Expect = 8e-14 Identities = 35/67 (52%), Positives = 53/67 (79%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ +ITSG SSD+F SN+LL++YSK+G LQ A +F+ +PR+N+MS NILI GF+ D Sbjct: 59 HSLLITSGCSSDKFASNHLLNLYSKIGDLQSASALFRHLPRRNIMSGNILINGFVQIGDL 118 Query: 23 QTARRIF 3 ++A+++F Sbjct: 119 ESAQKVF 125 >tpg|DAA50652.1| TPA: hypothetical protein ZEAMMB73_776700 [Zea mays] Length = 647 Score = 82.0 bits (201), Expect = 1e-13 Identities = 37/67 (55%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF TSGA++DRFT+N+LL Y+ LG A +F+R+P++NVMS NILIGG++ N D Sbjct: 65 HAFAATSGAAADRFTANHLLLAYADLGDFPTARGLFERIPKRNVMSWNILIGGYVKNGDL 124 Query: 23 QTARRIF 3 +TAR++F Sbjct: 125 ETARKLF 131 >ref|XP_008228981.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g41080 [Prunus mume] Length = 662 Score = 81.6 bits (200), Expect = 2e-13 Identities = 34/67 (50%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ IITSG S+D+F SN++L+ YSK+G L AL +F +PR+N+MS NILI G++ N D Sbjct: 88 HSLIITSGCSADKFVSNHILNFYSKIGDLGAALTLFGHLPRRNIMSCNILINGYVQNGDL 147 Query: 23 QTARRIF 3 ++A+++F Sbjct: 148 ESAQKVF 154 >ref|XP_006650794.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Oryza brachyantha] Length = 638 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/67 (58%), Positives = 51/67 (76%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF ITSGA++DRFT NNL+ Y+ LG L A D+F+R+PR+NVMS NIL G +I N D Sbjct: 56 HAFAITSGAAADRFTVNNLMLAYADLGDLPAARDLFERIPRRNVMSWNILFGVYIKNGDL 115 Query: 23 QTARRIF 3 +AR++F Sbjct: 116 GSARKLF 122 >ref|XP_004970613.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Setaria italica] Length = 647 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/67 (56%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF TSGA++DRFT+N+LL Y+ LG A +F+R+P++NVMS NILIGG+I N D Sbjct: 65 HAFAATSGAATDRFTANHLLLAYADLGDFPTARCLFERIPKRNVMSWNILIGGYIKNGDL 124 Query: 23 QTARRIF 3 +TAR++F Sbjct: 125 ETARKLF 131 >ref|XP_006348896.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080-like [Solanum tuberosum] Length = 658 Score = 81.3 bits (199), Expect = 2e-13 Identities = 35/67 (52%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ I+TSG D+F SN+LL+ YSKLGQL IA+ +F ++P++NVMS NILIGG++ D Sbjct: 76 HSLIVTSGCFRDKFVSNHLLNAYSKLGQLDIAVSLFDKLPKRNVMSFNILIGGYVQIGDL 135 Query: 23 QTARRIF 3 ++A ++F Sbjct: 136 ESASKVF 142 >ref|XP_007216453.1| hypothetical protein PRUPE_ppa023564mg [Prunus persica] gi|462412603|gb|EMJ17652.1| hypothetical protein PRUPE_ppa023564mg [Prunus persica] Length = 670 Score = 81.3 bits (199), Expect = 2e-13 Identities = 34/67 (50%), Positives = 52/67 (77%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ IITSG S+D+F SN+LL+ YSK+G L +AL +F +PR+N+MS NILI G++ D Sbjct: 88 HSLIITSGCSADKFVSNHLLNFYSKVGDLGVALTLFGHLPRRNIMSCNILINGYVQKGDL 147 Query: 23 QTARRIF 3 ++A+++F Sbjct: 148 ESAQKVF 154 >ref|XP_002464150.1| hypothetical protein SORBIDRAFT_01g013130 [Sorghum bicolor] gi|241918004|gb|EER91148.1| hypothetical protein SORBIDRAFT_01g013130 [Sorghum bicolor] Length = 472 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/67 (56%), Positives = 51/67 (76%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF TSGA++DRFT+N+LL Y+ LG A +F R+P++NVMS NILIGG+I N D Sbjct: 66 HAFAATSGAAADRFTANHLLLGYADLGDFPAARALFDRIPKRNVMSWNILIGGYIKNGDL 125 Query: 23 QTARRIF 3 +TAR++F Sbjct: 126 ETARKLF 132 >ref|XP_004243267.1| PREDICTED: pentatricopeptide repeat-containing protein At2g41080 [Solanum lycopersicum] Length = 658 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/67 (52%), Positives = 51/67 (76%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 H+ I+TSG D+F SN+LL+ YSKLGQL IA+ +F ++P++NVMS NILIGG++ D Sbjct: 76 HSLIVTSGCFRDKFVSNHLLNAYSKLGQLDIAVTLFDKLPKRNVMSFNILIGGYVQIGDL 135 Query: 23 QTARRIF 3 +A ++F Sbjct: 136 DSASKVF 142 >emb|CDM83637.1| unnamed protein product [Triticum aestivum] Length = 649 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/67 (55%), Positives = 50/67 (74%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF T GA++DRFT+NNL+ Y+ LG L A +F+R+P +NVMS NILIGG+I N D Sbjct: 67 HAFAATCGAAADRFTTNNLMLAYADLGDLPTACSLFERIPSRNVMSWNILIGGYIKNGDL 126 Query: 23 QTARRIF 3 +AR++F Sbjct: 127 GSARKLF 133 >gb|EEE60175.1| hypothetical protein OsJ_13106 [Oryza sativa Japonica Group] Length = 628 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF TSGA++DRFT+N+L+ Y+ LG L A ++F+R+PR+NVMS NIL GG+I N D Sbjct: 64 HAFAATSGAATDRFTANHLMLAYADLGDLTAARELFERIPRRNVMSWNILFGGYIKNGDL 123 Query: 23 QTARRIF 3 AR++F Sbjct: 124 GGARKLF 130 >gb|EEC76412.1| hypothetical protein OsI_14066 [Oryza sativa Indica Group] Length = 628 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF TSGA++DRFT+N+L+ Y+ LG L A ++F+R+PR+NVMS NIL GG+I N D Sbjct: 64 HAFAATSGAATDRFTANHLMLAYADLGDLTAARELFERIPRRNVMSWNILFGGYIKNGDL 123 Query: 23 QTARRIF 3 AR++F Sbjct: 124 GGARKLF 130 >gb|AAO60036.1| hypothetical protein [Oryza sativa Japonica Group] Length = 704 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/67 (55%), Positives = 51/67 (76%) Frame = -2 Query: 203 HAFIITSGASSDRFTSNNLLHMYSKLGQLQIALDIFKRMPRKNVMSSNILIGGFIHNDDF 24 HAF TSGA++DRFT+N+L+ Y+ LG L A ++F+R+PR+NVMS NIL GG+I N D Sbjct: 130 HAFAATSGAATDRFTANHLMLAYADLGDLTAARELFERIPRRNVMSWNILFGGYIKNGDL 189 Query: 23 QTARRIF 3 AR++F Sbjct: 190 GGARKLF 196