BLASTX nr result
ID: Anemarrhena21_contig00022352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022352 (512 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005173987.1| PREDICTED: putative proline-rich protein 21 ... 62 1e-07 >ref|XP_005173987.1| PREDICTED: putative proline-rich protein 21 [Danio rerio] Length = 339 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/87 (43%), Positives = 46/87 (52%), Gaps = 3/87 (3%) Frame = +1 Query: 19 SREPH-HVA--TDFCNPPSPRLCLPKMNSNPPSPHLCLPKMNSNPPSPRLCLLNMMSSNP 189 S PH HV T PP P L + +S PP PHL + +S PP P L L++ SS P Sbjct: 32 STRPHPHVLIHTASSTPPHPHLLIHTSSSTPPHPHLLIHTSSSTPPHPHL-LIHTSSSTP 90 Query: 190 PSPRLCLLNMMSSNPPSPHLCLPNISS 270 P P L L+N SS PP PH + SS Sbjct: 91 PHPHL-LINTSSSTPPHPHRLIHTSSS 116 Score = 58.9 bits (141), Expect = 1e-06 Identities = 33/79 (41%), Positives = 41/79 (51%), Gaps = 3/79 (3%) Frame = +1 Query: 19 SREPHH---VATDFCNPPSPRLCLPKMNSNPPSPHLCLPKMNSNPPSPRLCLLNMMSSNP 189 S PH + T PP P L + +S PP PHL + +S PP P L L+N SS P Sbjct: 46 STPPHPHLLIHTSSSTPPHPHLLIHTSSSTPPHPHLLIHTSSSTPPHPHL-LINTSSSTP 104 Query: 190 PSPRLCLLNMMSSNPPSPH 246 P P L++ SS PP PH Sbjct: 105 PHPHR-LIHTSSSTPPHPH 122 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/71 (42%), Positives = 40/71 (56%) Frame = +1 Query: 58 PPSPRLCLPKMNSNPPSPHLCLPKMNSNPPSPRLCLLNMMSSNPPSPRLCLLNMMSSNPP 237 PP P L + +S P PH+ + +S PP P L L++ SS PP P L L++ SS PP Sbjct: 20 PPHPHLLIHTASSTRPHPHVLIHTASSTPPHPHL-LIHTSSSTPPHPHL-LIHTSSSTPP 77 Query: 238 SPHLCLPNISS 270 PHL + SS Sbjct: 78 HPHLLIHTSSS 88