BLASTX nr result
ID: Anemarrhena21_contig00022294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022294 (278 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010928464.1| PREDICTED: uncharacterized protein LOC105050... 57 5e-06 ref|XP_004510947.1| PREDICTED: uncharacterized protein LOC101510... 57 5e-06 ref|XP_010102633.1| hypothetical protein L484_010922 [Morus nota... 57 6e-06 ref|XP_004149606.1| PREDICTED: uncharacterized protein LOC101207... 57 6e-06 ref|XP_008461780.1| PREDICTED: uncharacterized protein LOC103500... 56 8e-06 >ref|XP_010928464.1| PREDICTED: uncharacterized protein LOC105050226 [Elaeis guineensis] Length = 359 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/49 (61%), Positives = 37/49 (75%), Gaps = 6/49 (12%) Frame = -2 Query: 130 MDLPVVDLSAYLSISSP------SEDLTALCSAVSRSLRETGALLVKDP 2 MDLPVVDL+ YL+I+ +E+L LC+ VSRSLR+TGALLVKDP Sbjct: 1 MDLPVVDLAPYLAIAGSRDPAAVNEELRELCAVVSRSLRDTGALLVKDP 49 >ref|XP_004510947.1| PREDICTED: uncharacterized protein LOC101510204 [Cicer arietinum] Length = 351 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 130 MDLPVVDLSAYLSISSPSE-DLTALCSAVSRSLRETGALLVKDP 2 M+LPV+DLS+YLS+S+ + L +LC VSR LRETGALLVKDP Sbjct: 1 MELPVIDLSSYLSVSTDLDPQLRSLCGDVSRCLRETGALLVKDP 44 >ref|XP_010102633.1| hypothetical protein L484_010922 [Morus notabilis] gi|587905643|gb|EXB93783.1| hypothetical protein L484_010922 [Morus notabilis] Length = 334 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -2 Query: 130 MDLPVVDLSAYLSISSPSEDLTALCSAVSRSLRETGALLVKDP 2 MDLPV+DLS YLS ++ E + +C VSRSLRETGALLVKDP Sbjct: 1 MDLPVIDLSEYLS-AADGERVAEICGEVSRSLRETGALLVKDP 42 >ref|XP_004149606.1| PREDICTED: uncharacterized protein LOC101207443 [Cucumis sativus] gi|700203479|gb|KGN58612.1| hypothetical protein Csa_3G698530 [Cucumis sativus] Length = 363 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 9/52 (17%) Frame = -2 Query: 130 MDLPVVDLSAYLSISSP---------SEDLTALCSAVSRSLRETGALLVKDP 2 MDLPV+DL++YL+ SS S LT+LC VSR+L+ETGALLVKDP Sbjct: 1 MDLPVIDLASYLTASSELAAGSPIDFSPQLTSLCEVVSRTLKETGALLVKDP 52 >ref|XP_008461780.1| PREDICTED: uncharacterized protein LOC103500302 [Cucumis melo] Length = 363 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 9/52 (17%) Frame = -2 Query: 130 MDLPVVDLSAYLSISSP---------SEDLTALCSAVSRSLRETGALLVKDP 2 MDLPV+DL++YL+ SS S LT+LC VSR+L+ETGALLVKDP Sbjct: 1 MDLPVIDLASYLTASSALAAGSPIDFSPQLTSLCELVSRTLKETGALLVKDP 52