BLASTX nr result
ID: Anemarrhena21_contig00022090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00022090 (201 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010936897.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A... 57 5e-06 ref|XP_008777196.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A... 57 6e-06 >ref|XP_010936897.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Elaeis guineensis] Length = 172 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/52 (59%), Positives = 39/52 (75%) Frame = -2 Query: 158 MGLSNNLADVSSDSIPILILMSAVKSVSYIRYLFFCLLHSVVGPGLSQPPPS 3 MGLSN L DVSSDSIPIL+L++A + V+Y+R L CLLHS+ GL + PS Sbjct: 1 MGLSNRLHDVSSDSIPILLLVTAAEWVAYLRSLLLCLLHSL---GLLRLHPS 49 >ref|XP_008777196.1| PREDICTED: E3 ubiquitin-protein ligase RHA2A-like [Phoenix dactylifera] Length = 168 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 158 MGLSNNLADVSSDSIPILILMSAVKSVSYIRYLFFCLLHSV 36 MGLSN L DVSSDSIPIL++++A + VSY+R L CLLHS+ Sbjct: 1 MGLSNRLHDVSSDSIPILLVVTAAEWVSYLRSLLLCLLHSL 41