BLASTX nr result
ID: Anemarrhena21_contig00021886
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00021886 (493 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63079.1| hypothetical protein 17.t00006 [Asparagus officin... 83 6e-14 gb|ABD63097.1| hypothetical protein 17.t00024 [Asparagus officin... 74 4e-11 >gb|ABD63079.1| hypothetical protein 17.t00006 [Asparagus officinalis] Length = 123 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/68 (61%), Positives = 47/68 (69%) Frame = +3 Query: 3 DSIDSRLGISSWYRRFHPDSPLHPSYVVLGDSRPPLIFGVAVQSLEVPEVEPVQSENDTP 182 DS++SRLGISSW+RRFHPD+PLH +YV LG PPL FGV E P VEPVQ D Sbjct: 49 DSVESRLGISSWHRRFHPDTPLHTNYVTLGGELPPLRFGVITPPPEDPPVEPVQPNEDQ- 107 Query: 183 FTRSRILR 206 RSRI R Sbjct: 108 -MRSRIAR 114 >gb|ABD63097.1| hypothetical protein 17.t00024 [Asparagus officinalis] Length = 353 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/71 (50%), Positives = 48/71 (67%) Frame = +3 Query: 3 DSIDSRLGISSWYRRFHPDSPLHPSYVVLGDSRPPLIFGVAVQSLEVPEVEPVQSENDTP 182 DS++SRLGISSW++RFHPD+PLHP+YV LG+ PL FG+ E P VEPVQ + Sbjct: 230 DSVESRLGISSWHQRFHPDTPLHPNYVTLGELL-PLRFGLITPPPEDPPVEPVQPDEGNL 288 Query: 183 FTRSRILRTVV 215 S+ R ++ Sbjct: 289 AQESQATREIL 299