BLASTX nr result
ID: Anemarrhena21_contig00021833
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00021833 (429 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009383019.1| PREDICTED: pentatricopeptide repeat-containi... 54 7e-10 >ref|XP_009383019.1| PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Musa acuminata subsp. malaccensis] Length = 877 Score = 53.5 bits (127), Expect(2) = 7e-10 Identities = 27/51 (52%), Positives = 35/51 (68%), Gaps = 1/51 (1%) Frame = +1 Query: 205 SIVDYKGMLHLYFKSGIDLIKGLAGIVLEMKRFEPYTNVFTFDILFKG-CA 354 SI+DY G+L+ Y +SG + LA + EMKRF P NV+TF+ILF G CA Sbjct: 240 SILDYNGLLYRYLRSGHVSVDALANLFAEMKRFGPCPNVWTFNILFNGLCA 290 Score = 36.2 bits (82), Expect(2) = 7e-10 Identities = 13/23 (56%), Positives = 19/23 (82%) Frame = +3 Query: 348 VCSLGLLKAAFFILEDMWCHRIV 416 +C+LG L+ AF++LE+MW HR V Sbjct: 288 LCALGYLEDAFYVLEEMWSHRFV 310