BLASTX nr result
ID: Anemarrhena21_contig00021696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00021696 (379 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008789244.1| PREDICTED: annexin D5 [Phoenix dactylifera] 63 7e-08 ref|XP_010932515.1| PREDICTED: annexin D5 [Elaeis guineensis] gi... 63 9e-08 ref|XP_009391425.1| PREDICTED: annexin D5 [Musa acuminata subsp.... 62 1e-07 >ref|XP_008789244.1| PREDICTED: annexin D5 [Phoenix dactylifera] Length = 316 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 283 MSTLTVPPNLSSPRQDAIDLYKAFKGFGCDSS 378 MSTL+VPP LSSPRQDAIDLYKAFKGFGCDS+ Sbjct: 1 MSTLSVPPVLSSPRQDAIDLYKAFKGFGCDSA 32 >ref|XP_010932515.1| PREDICTED: annexin D5 [Elaeis guineensis] gi|743823387|ref|XP_010932516.1| PREDICTED: annexin D5 [Elaeis guineensis] Length = 316 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 283 MSTLTVPPNLSSPRQDAIDLYKAFKGFGCDSS 378 MSTL++PP LSSPRQDAIDLYKAFKGFGCDS+ Sbjct: 1 MSTLSIPPVLSSPRQDAIDLYKAFKGFGCDSA 32 >ref|XP_009391425.1| PREDICTED: annexin D5 [Musa acuminata subsp. malaccensis] Length = 316 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 283 MSTLTVPPNLSSPRQDAIDLYKAFKGFGCDSS 378 MSTL+VPP L+SPRQDAIDLYKAFKGFGCDS+ Sbjct: 1 MSTLSVPPFLTSPRQDAIDLYKAFKGFGCDSA 32