BLASTX nr result
ID: Anemarrhena21_contig00021501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00021501 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935852.1| PREDICTED: short-chain dehydrogenase TIC 32,... 62 1e-07 ref|XP_010935851.1| PREDICTED: short-chain dehydrogenase TIC 32,... 62 1e-07 ref|XP_009386208.1| PREDICTED: short-chain dehydrogenase TIC 32,... 62 2e-07 ref|XP_008787473.1| PREDICTED: short-chain dehydrogenase TIC 32,... 61 3e-07 ref|NP_001240197.1| uncharacterized protein LOC100783465 [Glycin... 57 6e-06 >ref|XP_010935852.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like isoform X2 [Elaeis guineensis] Length = 267 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 179 MWPFSRKGASGFNWYSTAEQVTEGLDGSGL 268 MWPFSRKG SGF+WYSTAE+VT+GLDGSGL Sbjct: 1 MWPFSRKGPSGFSWYSTAEEVTQGLDGSGL 30 >ref|XP_010935851.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like isoform X1 [Elaeis guineensis] Length = 313 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +2 Query: 179 MWPFSRKGASGFNWYSTAEQVTEGLDGSGL 268 MWPFSRKG SGF+WYSTAE+VT+GLDGSGL Sbjct: 1 MWPFSRKGPSGFSWYSTAEEVTQGLDGSGL 30 >ref|XP_009386208.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 313 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +2 Query: 179 MWPFSRKGASGFNWYSTAEQVTEGLDGSGL 268 MWPFSRKGASGF+W STAE+VTEGLDGSGL Sbjct: 1 MWPFSRKGASGFSWSSTAEEVTEGLDGSGL 30 >ref|XP_008787473.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic-like [Phoenix dactylifera] Length = 313 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +2 Query: 179 MWPFSRKGASGFNWYSTAEQVTEGLDGSGL 268 MWPFSRKG SGF+WYSTAE+VT+G DGSGL Sbjct: 1 MWPFSRKGPSGFSWYSTAEEVTQGFDGSGL 30 >ref|NP_001240197.1| uncharacterized protein LOC100783465 [Glycine max] gi|255644813|gb|ACU22908.1| unknown [Glycine max] Length = 349 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +2 Query: 173 KEMWPFSRKGASGFNWYSTAEQVTEGLDGSGL 268 ++MWPFSRKGASGF+ STAEQVTEG+DG+GL Sbjct: 35 QKMWPFSRKGASGFSSSSTAEQVTEGIDGTGL 66