BLASTX nr result
ID: Anemarrhena21_contig00020429
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00020429 (209 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus g... 79 9e-13 ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Popu... 63 9e-08 ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Popu... 60 4e-07 gb|KDO41824.1| hypothetical protein CISIN_1g036041mg, partial [C... 60 6e-07 ref|XP_002527490.1| conserved hypothetical protein [Ricinus comm... 60 7e-07 gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium r... 59 1e-06 ref|XP_002521818.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >gb|KCW52706.1| hypothetical protein EUGRSUZ_J02069 [Eucalyptus grandis] Length = 122 Score = 79.3 bits (194), Expect = 9e-13 Identities = 41/58 (70%), Positives = 45/58 (77%) Frame = -3 Query: 174 GV*ALYAGPPVPSRAVIRVVRAKAWVTRLLKRRAPREAGFTEQRIPPALDRGRITGRC 1 G+ L +GPPVPSR +I VVRAKA T +LK RAPREAGFTEQR PPA GRITGRC Sbjct: 65 GLQRLLSGPPVPSRELIHVVRAKARATCVLKWRAPREAGFTEQRKPPAPGSGRITGRC 122 >ref|XP_006387178.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] gi|550305511|gb|ERP46092.1| hypothetical protein POPTR_1605s00200g [Populus trichocarpa] Length = 72 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -3 Query: 177 SGV*ALYAGPPVPSRAVIRVVRAKAWVTRLLKRRAPREAGFTEQRIPPALDRGRITGRC 1 SG +GPPVPS+ + + + K WV+ LL+ RA REAG TEQR PA GRITGRC Sbjct: 5 SGSGCFLSGPPVPSQELSQGILVKTWVSWLLEGRAQREAGLTEQRSLPAPGSGRITGRC 63 >ref|XP_006372140.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] gi|550318586|gb|ERP49937.1| hypothetical protein POPTR_0018s12320g [Populus trichocarpa] Length = 83 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = -3 Query: 177 SGV*ALYAGPPVPSRAVIRVVRAKAWVTRLLKRRAPREAGFTEQRIPPALDRGRITGRC 1 SG L + PPVPS+ + + + K V+ LL+ RA REAG TEQR PPA GRITGRC Sbjct: 5 SGSGCLLSDPPVPSQELSQGILVKTLVSWLLEGRAQREAGLTEQRSPPAPGSGRITGRC 63 >gb|KDO41824.1| hypothetical protein CISIN_1g036041mg, partial [Citrus sinensis] Length = 90 Score = 60.1 bits (144), Expect = 6e-07 Identities = 32/49 (65%), Positives = 35/49 (71%) Frame = +2 Query: 5 RPVILPRSRAGGIRCSVKPASRGALRFKRRVTHAFARTTRITARLGTGG 151 RPVI P +RAGG RCSVKPASRG+L F +V AFARTT IT L G Sbjct: 13 RPVIHPLTRAGGRRCSVKPASRGSLHFSIQVIQAFARTTWITHYLDWAG 61 >ref|XP_002527490.1| conserved hypothetical protein [Ricinus communis] gi|223533130|gb|EEF34888.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/53 (56%), Positives = 32/53 (60%) Frame = -2 Query: 160 LCWSARSKSGSDSCGPCESVGHASLEAEGTA*GWLHRAANTSRS*PWKDNGPL 2 + W ARSK D CG E G AEGTA GW HRAA TS S WKDNGP+ Sbjct: 1 MIWLARSKLRVDPCGLGEGPGSMGPRAEGTALGWFHRAAITSLSWQWKDNGPV 53 >gb|KJB40315.1| hypothetical protein B456_007G057200 [Gossypium raimondii] Length = 79 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/54 (59%), Positives = 38/54 (70%) Frame = -3 Query: 162 LYAGPPVPSRAVIRVVRAKAWVTRLLKRRAPREAGFTEQRIPPALDRGRITGRC 1 L +G VPS+ + +V AKAWV LL+ +APREAGFTEQR P L GRITG C Sbjct: 8 LSSGLSVPSQELSQVSCAKAWVLWLLEWKAPREAGFTEQRKLPPLGSGRITGCC 61 >ref|XP_002521818.1| conserved hypothetical protein [Ricinus communis] gi|223539031|gb|EEF40628.1| conserved hypothetical protein [Ricinus communis] Length = 78 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/52 (61%), Positives = 34/52 (65%) Frame = -3 Query: 156 AGPPVPSRAVIRVVRAKAWVTRLLKRRAPREAGFTEQRIPPALDRGRITGRC 1 AG P PS + VV AK T LL+ R REAGFTEQR PPALD G ITG C Sbjct: 9 AGLPAPSGELSFVVLAKVGTTLLLEWRVLREAGFTEQRSPPALDSGWITGSC 60