BLASTX nr result
ID: Anemarrhena21_contig00020071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00020071 (424 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011464272.1| PREDICTED: uncharacterized protein LOC105351... 65 2e-08 gb|AEJ07891.1| putative coat protein [Pepper cryptic virus 1] 59 1e-06 >ref|XP_011464272.1| PREDICTED: uncharacterized protein LOC105351507 [Fragaria vesca subsp. vesca] Length = 380 Score = 65.1 bits (157), Expect = 2e-08 Identities = 36/79 (45%), Positives = 45/79 (56%), Gaps = 15/79 (18%) Frame = -2 Query: 405 EMCLAWFPMEGNYTMDDVTIAYIIGQACSPNLGYRDVE--PNNVA-------------RM 271 + C AWFP+ GNYTM+DVT+AYI+G AC+PNL RDV+ N R Sbjct: 210 DKCCAWFPL-GNYTMEDVTVAYIVGAACTPNLAPRDVDDWQNGTVTGNYSMDYERVEPRR 268 Query: 270 FYGAYEVRLEPNPNVYWTY 214 FYG YEVR+ V T+ Sbjct: 269 FYGDYEVRILEQRQVLPTF 287 >gb|AEJ07891.1| putative coat protein [Pepper cryptic virus 1] Length = 412 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/84 (40%), Positives = 40/84 (47%), Gaps = 18/84 (21%) Frame = -2 Query: 417 NDEKEMCLAWFPMEGNYTMDDVTIAYIIGQACSPNLGYRD------------------VE 292 +D ++C AWFP E N+ DVT AYIIG AC+P LG D E Sbjct: 234 HDNVQVC-AWFPREANFNSQDVTAAYIIGVACTPKLGPSDDDAWKYYASLNSVPTFTPTE 292 Query: 291 PNNVARMFYGAYEVRLEPNPNVYW 220 P R YGAYEVR N Y+ Sbjct: 293 PRLTNRRSYGAYEVRTRETENNYF 316