BLASTX nr result
ID: Anemarrhena21_contig00019725
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019725 (312 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63139.1| Reverse transcriptase family protein [Asparagus o... 79 2e-12 gb|ABD63088.1| hypothetical protein 17.t00015 [Asparagus officin... 58 2e-06 >gb|ABD63139.1| Reverse transcriptase family protein [Asparagus officinalis] Length = 1181 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/79 (48%), Positives = 52/79 (65%), Gaps = 1/79 (1%) Frame = +3 Query: 6 SDDEEDEPPQFFHYNPFAHQQMKKMGYDFQKQEGLGLRKGSPS-LAQPKAPRGKPIDYYH 182 S +E+D PQF ++ P + Q MK+MGY+F ++ GL KG + + AP GKP DYYH Sbjct: 459 SSEEDDGVPQFHYHEPNSIQLMKRMGYNFNEKRGLNFGKGRRTPVRMSLAPEGKPQDYYH 518 Query: 183 ITRWGLGYVTPPGLSDNEV 239 TR GLGYVT P S++E+ Sbjct: 519 KTRSGLGYVTTPSASEDEI 537 >gb|ABD63088.1| hypothetical protein 17.t00015 [Asparagus officinalis] Length = 125 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/54 (51%), Positives = 33/54 (61%), Gaps = 1/54 (1%) Frame = +3 Query: 60 HQQMKKMGYDFQKQEGLGLRKGSP-SLAQPKAPRGKPIDYYHITRWGLGYVTPP 218 H MKK+GYDF ++EGL KG + P GKP DYYH T GLGY +PP Sbjct: 2 HYLMKKIGYDFTRKEGLNFGKGRKIPIKHVYVPEGKPEDYYHKTHRGLGYESPP 55