BLASTX nr result
ID: Anemarrhena21_contig00019720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019720 (422 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011033721.1| PREDICTED: heat stress transcription factor ... 58 3e-06 ref|XP_002321069.1| hypothetical protein POPTR_0014s13780g [Popu... 58 3e-06 ref|XP_008776668.1| PREDICTED: heat stress transcription factor ... 57 4e-06 ref|XP_010916598.1| PREDICTED: heat stress transcription factor ... 57 5e-06 ref|XP_009406764.1| PREDICTED: heat stress transcription factor ... 57 6e-06 ref|XP_010655549.1| PREDICTED: heat stress transcription factor ... 56 8e-06 emb|CBI30730.3| unnamed protein product [Vitis vinifera] 56 8e-06 >ref|XP_011033721.1| PREDICTED: heat stress transcription factor A-4b-like [Populus euphratica] Length = 444 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 324 MDGSSHGASNSPPPFLTKTYDMVDDPSTDSIVS 422 MDGS +SN+PPPFLTKTYDMVDDP T+S+VS Sbjct: 1 MDGSQSNSSNAPPPFLTKTYDMVDDPLTNSVVS 33 >ref|XP_002321069.1| hypothetical protein POPTR_0014s13780g [Populus trichocarpa] gi|222861842|gb|EEE99384.1| hypothetical protein POPTR_0014s13780g [Populus trichocarpa] Length = 443 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 324 MDGSSHGASNSPPPFLTKTYDMVDDPSTDSIVS 422 MDGS +SN+PPPFLTKTYDMVDDP T+S+VS Sbjct: 1 MDGSQSNSSNAPPPFLTKTYDMVDDPLTNSVVS 33 >ref|XP_008776668.1| PREDICTED: heat stress transcription factor A-4b-like [Phoenix dactylifera] gi|672195909|ref|XP_008776669.1| PREDICTED: heat stress transcription factor A-4b-like [Phoenix dactylifera] Length = 451 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +3 Query: 324 MDGSSHGA-SNSPPPFLTKTYDMVDDPSTDSIVS 422 M+GS G+ SNSPPPFLTKTYDMVDDPST+SIVS Sbjct: 1 MEGSQGGSGSNSPPPFLTKTYDMVDDPSTNSIVS 34 >ref|XP_010916598.1| PREDICTED: heat stress transcription factor A-4b-like [Elaeis guineensis] Length = 451 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%), Gaps = 1/34 (2%) Frame = +3 Query: 324 MDGSSHG-ASNSPPPFLTKTYDMVDDPSTDSIVS 422 M+GS G ASNSPPPFLTKTY+MVDDPST+SIVS Sbjct: 1 MEGSQGGSASNSPPPFLTKTYEMVDDPSTNSIVS 34 >ref|XP_009406764.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata subsp. malaccensis] gi|695038504|ref|XP_009406765.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata subsp. malaccensis] gi|695038506|ref|XP_009406766.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata subsp. malaccensis] gi|695038508|ref|XP_009406767.1| PREDICTED: heat stress transcription factor A-4b-like [Musa acuminata subsp. malaccensis] Length = 441 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = +3 Query: 324 MDGSSHGASNSPPPFLTKTYDMVDDPSTDSIVS 422 M+GS G+SNSPPPFLTKTY+MVDDPST+SIVS Sbjct: 1 MEGS-RGSSNSPPPFLTKTYEMVDDPSTNSIVS 32 >ref|XP_010655549.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera] gi|731404782|ref|XP_010655550.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera] gi|731404784|ref|XP_010655551.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera] gi|731404786|ref|XP_010655552.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera] gi|731404788|ref|XP_010655553.1| PREDICTED: heat stress transcription factor A-4a [Vitis vinifera] Length = 448 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 336 SHGASNSPPPFLTKTYDMVDDPSTDSIVS 422 S G+SNSPPPFLTKTY+MVDDP+TDSIVS Sbjct: 4 SPGSSNSPPPFLTKTYEMVDDPTTDSIVS 32 >emb|CBI30730.3| unnamed protein product [Vitis vinifera] Length = 354 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 336 SHGASNSPPPFLTKTYDMVDDPSTDSIVS 422 S G+SNSPPPFLTKTY+MVDDP+TDSIVS Sbjct: 4 SPGSSNSPPPFLTKTYEMVDDPTTDSIVS 32