BLASTX nr result
ID: Anemarrhena21_contig00019657
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019657 (328 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008808801.1| PREDICTED: uncharacterized protein LOC103720... 58 3e-06 >ref|XP_008808801.1| PREDICTED: uncharacterized protein LOC103720733 [Phoenix dactylifera] Length = 46 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -1 Query: 283 SIMIRSPSLLFTIS-ILQNLRVLGPGLNPFAPHGMGNYSVSR 161 S ++ S S+ +IS +LQNLRV GPGLNPFAP GMGNYSVSR Sbjct: 5 SFLVSSCSIADSISSVLQNLRVFGPGLNPFAPFGMGNYSVSR 46