BLASTX nr result
ID: Anemarrhena21_contig00019540
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019540 (237 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EDM51784.1| hypothetical protein EUBVEN_00788 [Eubacterium ve... 65 2e-08 gb|EDK22935.1| hypothetical protein RUMTOR_02906 [Ruminococcus t... 64 3e-08 emb|CDZ90521.1| conserved hypothetical protein [Rhodococcus rube... 58 3e-06 >gb|EDM51784.1| hypothetical protein EUBVEN_00788 [Eubacterium ventriosum ATCC 27560] Length = 92 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +2 Query: 2 AASRRSLARISVPVWGINLSGPLLIIVLVVRYTAN*LIKRMPILYHRSFN 151 AASRRSL R+SVP+W I LS LLI+ LV RY N LI+R ILYHRSF+ Sbjct: 31 AASRRSLGRVSVPMWPITLSSRLLIVALVGRYLTNQLIRRGSILYHRSFS 80 >gb|EDK22935.1| hypothetical protein RUMTOR_02906 [Ruminococcus torques ATCC 27756] Length = 103 Score = 64.3 bits (155), Expect = 3e-08 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = +2 Query: 2 AASRRSLARISVPVWGINLSGPLLIIVLVVRYTAN*LIKRMPILYHRSF 148 AASRRSL R+SVP+W + LSG LLI+ LV RY N LI+R I YHRSF Sbjct: 42 AASRRSLGRVSVPMWPVTLSGRLLIVALVSRYLTNQLIRRGSISYHRSF 90 >emb|CDZ90521.1| conserved hypothetical protein [Rhodococcus ruber] gi|697989431|emb|CDZ90311.1| conserved hypothetical protein [Rhodococcus ruber] Length = 161 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = +2 Query: 2 AASRRSLARISVPVWGINLSGPLLIIVLVVRYTAN*LIKRMPILYHRSF 148 AASRRSL R+SVPVW + LSG L ++ LV RY N LI R PIL+ ++F Sbjct: 46 AASRRSLGRVSVPVWPVALSGRLPVVALVGRYPTNKLIGRGPILHRKTF 94