BLASTX nr result
ID: Anemarrhena21_contig00019491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019491 (502 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK44684.1| unknown [Lotus japonicus] 92 1e-16 ref|XP_011077684.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_011077105.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_010263429.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_009416416.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_009389359.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_008795046.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_003525317.1| PREDICTED: mitochondrial import receptor sub... 91 4e-16 ref|XP_012850170.1| PREDICTED: mitochondrial import receptor sub... 90 5e-16 ref|XP_003530621.1| PREDICTED: mitochondrial import receptor sub... 90 5e-16 ref|XP_008810028.1| PREDICTED: mitochondrial import receptor sub... 90 7e-16 ref|XP_010915807.1| PREDICTED: mitochondrial import receptor sub... 89 9e-16 ref|XP_012079254.1| PREDICTED: mitochondrial import receptor sub... 89 9e-16 ref|XP_011623506.1| PREDICTED: mitochondrial import receptor sub... 89 1e-15 gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -lik... 89 1e-15 ref|XP_004299770.1| PREDICTED: mitochondrial import receptor sub... 89 1e-15 ref|XP_009362070.1| PREDICTED: mitochondrial import receptor sub... 89 2e-15 ref|XP_008391413.1| PREDICTED: mitochondrial import receptor sub... 89 2e-15 ref|XP_004503550.1| PREDICTED: mitochondrial import receptor sub... 89 2e-15 ref|XP_012463735.1| PREDICTED: mitochondrial import receptor sub... 88 2e-15 >gb|AFK44684.1| unknown [Lotus japonicus] Length = 72 Score = 92.0 bits (227), Expect = 1e-16 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 +C+KEWTTWTM+KAKVVTHYGFIPLIIIIGMNS+PKP LSQLLSPV Sbjct: 27 ECLKEWTTWTMRKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 72 >ref|XP_011077684.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 K VKEW+TWTMKKAKV+THYGFIP++IIIGMNSEPKP+LSQLLSPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_011077105.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Sesamum indicum] Length = 78 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 K VKEW+TWTMKKAKV+THYGFIP++IIIGMNSEPKP+LSQLLSPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPMVIIIGMNSEPKPSLSQLLSPV 78 >ref|XP_010263429.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Nelumbo nucifera] Length = 89 Score = 90.5 bits (223), Expect = 4e-16 Identities = 38/45 (84%), Positives = 45/45 (100%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSP 200 KC+K+W+TWTMKKAKV+THYGFIPL+IIIG+NSEPKPTLSQLL+P Sbjct: 44 KCLKDWSTWTMKKAKVITHYGFIPLVIIIGVNSEPKPTLSQLLTP 88 >ref|XP_009416416.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Musa acuminata subsp. malaccensis] Length = 71 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 KCVKEW+TW MKKAKV+THYGFIPLI+IIGMNSEPKP L QLLSPV Sbjct: 26 KCVKEWSTWAMKKAKVITHYGFIPLIVIIGMNSEPKPQLYQLLSPV 71 >ref|XP_009389359.1| PREDICTED: mitochondrial import receptor subunit TOM7-2-like [Musa acuminata subsp. malaccensis] Length = 73 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 KCVKEW+TW MKKAKV+THYGFIPLII+IGMNSEPKP L QLLSPV Sbjct: 28 KCVKEWSTWAMKKAKVITHYGFIPLIIVIGMNSEPKPQLYQLLSPV 73 >ref|XP_008795046.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 69 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 DG +CVK+W+TW MKKAKVV HYGFIPLII+IGMNSEPKP LSQL+SPV Sbjct: 19 DGSTARCVKDWSTWAMKKAKVVAHYGFIPLIIVIGMNSEPKPHLSQLVSPV 69 >ref|XP_003525317.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|734310475|gb|KHM99855.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] Length = 72 Score = 90.5 bits (223), Expect = 4e-16 Identities = 39/51 (76%), Positives = 46/51 (90%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 D ++C+KEWTTW M+KAKV+THYGFIPL+IIIGMNS+PKP LSQLLSPV Sbjct: 22 DRSASECLKEWTTWAMRKAKVITHYGFIPLVIIIGMNSDPKPPLSQLLSPV 72 >ref|XP_012850170.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Erythranthe guttatus] gi|604313221|gb|EYU26552.1| hypothetical protein MIMGU_mgv1a017391mg [Erythranthe guttata] Length = 78 Score = 90.1 bits (222), Expect = 5e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 K VKEW+TWTMKKAKV+THYGFIPL+IIIGMNS+PKP+LSQLLSPV Sbjct: 33 KFVKEWSTWTMKKAKVITHYGFIPLVIIIGMNSDPKPSLSQLLSPV 78 >ref|XP_003530621.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like isoform 1 [Glycine max] gi|734363636|gb|KHN16697.1| Mitochondrial import receptor subunit TOM7-1 [Glycine soja] Length = 72 Score = 90.1 bits (222), Expect = 5e-16 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 D ++C+KEWTTW M+KAKV+THYGFIPL+I+IGMNS+PKP LSQLLSPV Sbjct: 22 DRSASECLKEWTTWAMRKAKVITHYGFIPLVIVIGMNSDPKPPLSQLLSPV 72 >ref|XP_008810028.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Phoenix dactylifera] Length = 72 Score = 89.7 bits (221), Expect = 7e-16 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 +CVK W+TW MKKAKV+THYGFIPLIIIIGMNSEPKP LSQLLSPV Sbjct: 27 RCVKTWSTWAMKKAKVITHYGFIPLIIIIGMNSEPKPQLSQLLSPV 72 >ref|XP_010915807.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Elaeis guineensis] Length = 69 Score = 89.4 bits (220), Expect = 9e-16 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 DG + VKEW+TWTMKKAKV+ HYGFIPLII+IGMNSEPKP LSQLLSPV Sbjct: 19 DGPTARFVKEWSTWTMKKAKVIAHYGFIPLIIVIGMNSEPKPHLSQLLSPV 69 >ref|XP_012079254.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Jatropha curcas] gi|643722074|gb|KDP31953.1| hypothetical protein JCGZ_12414 [Jatropha curcas] Length = 74 Score = 89.4 bits (220), Expect = 9e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 +C+KEW+TWTMKKAKVVTHYGFIPLIIIIGMNSEPKP L QLL+PV Sbjct: 29 QCLKEWSTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPQLYQLLTPV 74 >ref|XP_011623506.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Amborella trichopoda] Length = 71 Score = 89.0 bits (219), Expect = 1e-15 Identities = 39/45 (86%), Positives = 43/45 (95%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSP 200 KCVKEW+TWT+KKAKVV HYGFIPLII+IGMNSEPKP LSQL+SP Sbjct: 26 KCVKEWSTWTLKKAKVVAHYGFIPLIIVIGMNSEPKPYLSQLVSP 70 >gb|KHG28073.1| Mitochondrial import receptor subunit TOM7-1 -like protein [Gossypium arboreum] Length = 72 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 D +C+KEW+TW MKKAKVVTHYGFIPL+IIIGMNSEPKP L QLLSPV Sbjct: 22 DKSTTQCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72 >ref|XP_004299770.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Fragaria vesca subsp. vesca] Length = 73 Score = 89.0 bits (219), Expect = 1e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 + VKEWT WTMKKAKVVTHYGFIPLIIIIGMNS+PKP LSQLLSPV Sbjct: 28 QAVKEWTNWTMKKAKVVTHYGFIPLIIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_009362070.1| PREDICTED: mitochondrial import receptor subunit TOM7-1-like [Pyrus x bretschneideri] Length = 73 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/51 (78%), Positives = 45/51 (88%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 +G + VKEW+TW MKKAKVVTHYGFIPL+IIIGMNS+PKP LSQLLSPV Sbjct: 23 EGSVAQSVKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_008391413.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Malus domestica] Length = 73 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -1 Query: 328 VKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 VKEW+TWTMKKAKVVTHYGFIPL+IIIGMNS+PKP LSQLLSPV Sbjct: 30 VKEWSTWTMKKAKVVTHYGFIPLVIIIGMNSDPKPQLSQLLSPV 73 >ref|XP_004503550.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Cicer arietinum] Length = 72 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = -1 Query: 349 DGGYNKCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 D Y C+KEWTTW ++KAKV+THYGFIP+II+IGMNS+PKP LSQLLSPV Sbjct: 22 DRSYVDCMKEWTTWGLRKAKVITHYGFIPMIILIGMNSDPKPQLSQLLSPV 72 >ref|XP_012463735.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|823261997|ref|XP_012463736.1| PREDICTED: mitochondrial import receptor subunit TOM7-1 [Gossypium raimondii] gi|763814322|gb|KJB81174.1| hypothetical protein B456_013G132400 [Gossypium raimondii] gi|763814323|gb|KJB81175.1| hypothetical protein B456_013G132400 [Gossypium raimondii] Length = 72 Score = 88.2 bits (217), Expect = 2e-15 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -1 Query: 334 KCVKEWTTWTMKKAKVVTHYGFIPLIIIIGMNSEPKPTLSQLLSPV 197 +C+KEW+TW MKKAKVVTHYGFIPL+IIIGMNSEPKP L QLLSPV Sbjct: 27 QCLKEWSTWAMKKAKVVTHYGFIPLVIIIGMNSEPKPQLYQLLSPV 72