BLASTX nr result
ID: Anemarrhena21_contig00019197
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019197 (250 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006294674.1| hypothetical protein CARUB_v10023709mg, part... 97 4e-18 ref|XP_007202361.1| hypothetical protein PRUPE_ppa009201mg [Prun... 96 7e-18 ref|XP_010088475.1| Proteasome subunit alpha type-3 [Morus notab... 94 5e-17 gb|KJB35635.1| hypothetical protein B456_006G122000 [Gossypium r... 94 5e-17 ref|XP_012485276.1| PREDICTED: proteasome subunit alpha type-3 i... 94 5e-17 gb|KJB35633.1| hypothetical protein B456_006G122000 [Gossypium r... 94 5e-17 ref|XP_012485277.1| PREDICTED: proteasome subunit alpha type-3 i... 94 5e-17 gb|KJB35631.1| hypothetical protein B456_006G122000 [Gossypium r... 94 5e-17 gb|KJB35588.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 gb|KJB35587.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 gb|KJB35586.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 gb|KJB35585.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 gb|KJB35584.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 gb|KJB35583.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 gb|KJB35582.1| hypothetical protein B456_006G121400 [Gossypium r... 94 5e-17 ref|XP_012485260.1| PREDICTED: proteasome subunit alpha type-3 [... 94 5e-17 ref|XP_011016306.1| PREDICTED: proteasome subunit alpha type-3-l... 94 5e-17 ref|XP_011042035.1| PREDICTED: proteasome subunit alpha type-3 [... 94 5e-17 ref|XP_010904710.1| PREDICTED: proteasome subunit alpha type-3 i... 94 5e-17 ref|XP_010922124.1| PREDICTED: proteasome subunit alpha type-3-l... 94 5e-17 >ref|XP_006294674.1| hypothetical protein CARUB_v10023709mg, partial [Capsella rubella] gi|482563382|gb|EOA27572.1| hypothetical protein CARUB_v10023709mg, partial [Capsella rubella] Length = 304 Score = 97.1 bits (240), Expect = 4e-18 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = +3 Query: 102 RTRTMSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 R+R MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTV+GIKCKDG Sbjct: 52 RSRKMSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVVGIKCKDG 100 >ref|XP_007202361.1| hypothetical protein PRUPE_ppa009201mg [Prunus persica] gi|462397892|gb|EMJ03560.1| hypothetical protein PRUPE_ppa009201mg [Prunus persica] Length = 302 Score = 96.3 bits (238), Expect = 7e-18 Identities = 53/69 (76%), Positives = 55/69 (79%) Frame = +3 Query: 42 SPLLLCCVQLAKPQNI*RLLRTRTMSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGT 221 S L C L++ N R R R MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGT Sbjct: 31 SQCLSICSFLSRALNNTRPKR-RKMSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGT 89 Query: 222 VIGIKCKDG 248 VIGIKCKDG Sbjct: 90 VIGIKCKDG 98 >ref|XP_010088475.1| Proteasome subunit alpha type-3 [Morus notabilis] gi|587845704|gb|EXB36245.1| Proteasome subunit alpha type-3 [Morus notabilis] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35635.1| hypothetical protein B456_006G122000 [Gossypium raimondii] Length = 174 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_012485276.1| PREDICTED: proteasome subunit alpha type-3 isoform X1 [Gossypium raimondii] gi|763768419|gb|KJB35634.1| hypothetical protein B456_006G122000 [Gossypium raimondii] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35633.1| hypothetical protein B456_006G122000 [Gossypium raimondii] Length = 196 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_012485277.1| PREDICTED: proteasome subunit alpha type-3 isoform X2 [Gossypium raimondii] gi|763768417|gb|KJB35632.1| hypothetical protein B456_006G122000 [Gossypium raimondii] Length = 227 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35631.1| hypothetical protein B456_006G122000 [Gossypium raimondii] Length = 250 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35588.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 236 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35587.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 196 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35586.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 209 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35585.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 250 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35584.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 227 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35583.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >gb|KJB35582.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 174 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_012485260.1| PREDICTED: proteasome subunit alpha type-3 [Gossypium raimondii] gi|763768366|gb|KJB35581.1| hypothetical protein B456_006G121400 [Gossypium raimondii] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_011016306.1| PREDICTED: proteasome subunit alpha type-3-like [Populus euphratica] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_011042035.1| PREDICTED: proteasome subunit alpha type-3 [Populus euphratica] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_010904710.1| PREDICTED: proteasome subunit alpha type-3 isoform X1 [Elaeis guineensis] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45 >ref|XP_010922124.1| PREDICTED: proteasome subunit alpha type-3-like [Elaeis guineensis] Length = 249 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/45 (100%), Positives = 45/45 (100%) Frame = +3 Query: 114 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 248 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG Sbjct: 1 MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVIGIKCKDG 45