BLASTX nr result
ID: Anemarrhena21_contig00019155
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00019155 (291 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJE29370.1| putative gag protein [Coffea canephora] 59 1e-06 >gb|AJE29370.1| putative gag protein [Coffea canephora] Length = 433 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/71 (46%), Positives = 43/71 (60%), Gaps = 1/71 (1%) Frame = -2 Query: 284 IGTVKVKSLGGTVRALEAVWYVPEARYNLIST*MLDEEG-*IQMQ*GVITISQGNKVILK 108 +G VK+K L G +R+L V YVP+ R NLIS LD EG GV+ I+ G V+L Sbjct: 324 VGVVKIKMLNGEIRSLGGVAYVPKLRRNLISLNQLDSEGYHFSAASGVLKITYGETVLLM 383 Query: 107 GEKCGRIYKLN 75 G+K G +Y LN Sbjct: 384 GKKYGNLYHLN 394