BLASTX nr result
ID: Anemarrhena21_contig00018989
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00018989 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT08752.1| BCNT [Hyacinthus orientalis] 65 2e-08 ref|XP_002519285.1| Craniofacial development protein, putative [... 61 3e-07 ref|XP_012084145.1| PREDICTED: craniofacial development protein ... 59 1e-06 ref|XP_008655874.1| PREDICTED: craniofacial development protein ... 57 4e-06 ref|XP_008655872.1| PREDICTED: craniofacial development protein ... 57 4e-06 ref|XP_008655873.1| PREDICTED: craniofacial development protein ... 57 4e-06 gb|AFW80663.1| hypothetical protein ZEAMMB73_072825 [Zea mays] 57 4e-06 ref|XP_012482243.1| PREDICTED: craniofacial development protein ... 57 6e-06 ref|XP_011011108.1| PREDICTED: craniofacial development protein ... 57 6e-06 ref|XP_011011100.1| PREDICTED: craniofacial development protein ... 57 6e-06 gb|KHG12800.1| tig [Gossypium arboreum] 57 6e-06 gb|KHG12799.1| Craniofacial development protein 1 [Gossypium arb... 57 6e-06 ref|XP_002314982.2| hypothetical protein POPTR_0010s16110g [Popu... 57 6e-06 gb|ABK95758.1| unknown [Populus trichocarpa] 57 6e-06 >gb|AAT08752.1| BCNT [Hyacinthus orientalis] Length = 147 Score = 64.7 bits (156), Expect = 2e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTDMREFERERDARLASQA RRT+MREDD Sbjct: 114 SFLQRTDMREFERERDARLASQAKRRTDMREDD 146 >ref|XP_002519285.1| Craniofacial development protein, putative [Ricinus communis] gi|223541600|gb|EEF43149.1| Craniofacial development protein, putative [Ricinus communis] Length = 298 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTD REFERERDARLA QA RRT+MREDD Sbjct: 265 SFLQRTDYREFERERDARLAQQARRRTDMREDD 297 >ref|XP_012084145.1| PREDICTED: craniofacial development protein 1 [Jatropha curcas] gi|643716202|gb|KDP27975.1| hypothetical protein JCGZ_19055 [Jatropha curcas] Length = 309 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTD REFERERDARLA QA R+T+MREDD Sbjct: 276 SFLQRTDYREFERERDARLALQARRKTDMREDD 308 >ref|XP_008655874.1| PREDICTED: craniofacial development protein 1-like isoform X3 [Zea mays] Length = 214 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTD REFERERDARL+ A RRT+MREDD Sbjct: 181 SFLQRTDYREFERERDARLSMMAKRRTDMREDD 213 >ref|XP_008655872.1| PREDICTED: craniofacial development protein 1-like isoform X1 [Zea mays] gi|413948016|gb|AFW80665.1| hypothetical protein ZEAMMB73_072825 [Zea mays] Length = 265 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTD REFERERDARL+ A RRT+MREDD Sbjct: 232 SFLQRTDYREFERERDARLSMMAKRRTDMREDD 264 >ref|XP_008655873.1| PREDICTED: craniofacial development protein 1-like isoform X2 [Zea mays] gi|413948015|gb|AFW80664.1| hypothetical protein ZEAMMB73_072825 [Zea mays] Length = 239 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTD REFERERDARL+ A RRT+MREDD Sbjct: 206 SFLQRTDYREFERERDARLSMMAKRRTDMREDD 238 >gb|AFW80663.1| hypothetical protein ZEAMMB73_072825 [Zea mays] Length = 343 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMREDD 196 SFLQRTD REFERERDARL+ A RRT+MREDD Sbjct: 149 SFLQRTDYREFERERDARLSMMAKRRTDMREDD 181 >ref|XP_012482243.1| PREDICTED: craniofacial development protein 1 [Gossypium raimondii] gi|763761530|gb|KJB28784.1| hypothetical protein B456_005G069300 [Gossypium raimondii] Length = 289 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFLQRTD REFERERDARLA QA RR EMRED Sbjct: 257 SFLQRTDYREFERERDARLALQARRRPEMRED 288 >ref|XP_011011108.1| PREDICTED: craniofacial development protein 1 isoform X2 [Populus euphratica] Length = 319 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFL+RTD REFERERDARLA QA RRT+MRED Sbjct: 287 SFLERTDYREFERERDARLALQARRRTDMRED 318 >ref|XP_011011100.1| PREDICTED: craniofacial development protein 1 isoform X1 [Populus euphratica] Length = 320 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFL+RTD REFERERDARLA QA RRT+MRED Sbjct: 288 SFLERTDYREFERERDARLALQARRRTDMRED 319 >gb|KHG12800.1| tig [Gossypium arboreum] Length = 218 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFLQRTD REFERERDARLA QA RR EMRED Sbjct: 186 SFLQRTDYREFERERDARLALQARRRPEMRED 217 >gb|KHG12799.1| Craniofacial development protein 1 [Gossypium arboreum] Length = 289 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFLQRTD REFERERDARLA QA RR EMRED Sbjct: 257 SFLQRTDYREFERERDARLALQARRRPEMRED 288 >ref|XP_002314982.2| hypothetical protein POPTR_0010s16110g [Populus trichocarpa] gi|550329915|gb|EEF01153.2| hypothetical protein POPTR_0010s16110g [Populus trichocarpa] Length = 320 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFL+RTD REFERERDARLA QA RRT+MRED Sbjct: 288 SFLERTDYREFERERDARLALQARRRTDMRED 319 >gb|ABK95758.1| unknown [Populus trichocarpa] Length = 287 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 294 SFLQRTDMREFERERDARLASQANRRTEMRED 199 SFL+RTD REFERERDARLA QA RRT+MRED Sbjct: 255 SFLERTDYREFERERDARLALQARRRTDMRED 286