BLASTX nr result
ID: Anemarrhena21_contig00018920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00018920 (616 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009400277.1| PREDICTED: uncharacterized protein LOC103984... 59 1e-06 >ref|XP_009400277.1| PREDICTED: uncharacterized protein LOC103984496 [Musa acuminata subsp. malaccensis] Length = 130 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/42 (66%), Positives = 32/42 (76%), Gaps = 3/42 (7%) Frame = -1 Query: 337 SVGYFSNISPSQEHN---EDDLDPVYGVSKRSVPQGPNPLHN 221 S+GYF ISPS EH+ E++ VYGVSKR VPQGPNPLHN Sbjct: 89 SMGYFPRISPSAEHDDEEEEEFSSVYGVSKRLVPQGPNPLHN 130