BLASTX nr result
ID: Anemarrhena21_contig00018491
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00018491 (446 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008803207.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_010930804.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 >ref|XP_008803207.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like [Phoenix dactylifera] gi|672166553|ref|XP_008803208.1| PREDICTED: pentatricopeptide repeat-containing protein At1g62910-like [Phoenix dactylifera] Length = 552 Score = 67.4 bits (163), Expect = 4e-09 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 1/61 (1%) Frame = -3 Query: 444 ENKNFEAAEKLLSDMASHGLEPNMAVYTILICSLCKAGNMEQAVHFMNELSSIG-QLNAK 268 + + F+AAE+LL DM HG EPN +Y +L+ LCKAGN ++A H++ E+S G Q+NAK Sbjct: 469 DTEQFDAAEELLCDMERHGFEPNSVIYNMLVYGLCKAGNFDRAEHYLEEMSHKGQQVNAK 528 Query: 267 S 265 + Sbjct: 529 T 529 >ref|XP_010930804.1| PREDICTED: pentatricopeptide repeat-containing protein At1g12775, mitochondrial-like [Elaeis guineensis] Length = 554 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/60 (48%), Positives = 43/60 (71%), Gaps = 1/60 (1%) Frame = -3 Query: 438 KNFEAAEKLLSDMASHGLEPNMAVYTILICSLCKAGNMEQAVHFMNELSSIG-QLNAKSY 262 + F+AAE+LL DM HGLEPN ++ L+ LCKAGN +A +++ E+S G Q+NAK++ Sbjct: 471 EQFDAAEELLCDMERHGLEPNSVIFNKLVYGLCKAGNFGRAEYYLEEMSRKGQQVNAKTH 530