BLASTX nr result
ID: Anemarrhena21_contig00017790
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017790 (515 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004289749.1| PREDICTED: LYR motif-containing protein At3g... 62 1e-07 ref|XP_008456173.1| PREDICTED: LYR motif-containing protein At3g... 61 3e-07 ref|XP_006346350.1| PREDICTED: LYR motif-containing protein At3g... 61 3e-07 ref|XP_004230727.1| PREDICTED: LYR motif-containing protein At3g... 61 3e-07 ref|XP_009610038.1| PREDICTED: LYR motif-containing protein At3g... 60 4e-07 ref|XP_008380588.1| PREDICTED: LYR motif-containing protein At3g... 60 7e-07 ref|XP_008236391.1| PREDICTED: LYR motif-containing protein At3g... 60 7e-07 ref|XP_012465891.1| PREDICTED: LYR motif-containing protein At3g... 59 1e-06 gb|KHG30324.1| hypothetical protein F383_11007 [Gossypium arboreum] 59 2e-06 ref|XP_009758975.1| PREDICTED: LYR motif-containing protein At3g... 59 2e-06 gb|KEH27327.1| UPF0631 plant-like protein [Medicago truncatula] 59 2e-06 ref|XP_004511298.1| PREDICTED: LYR motif-containing protein At3g... 59 2e-06 ref|XP_007199065.1| hypothetical protein PRUPE_ppa018678mg [Prun... 59 2e-06 ref|XP_004140718.1| PREDICTED: LYR motif-containing protein At3g... 58 2e-06 ref|XP_008338262.1| PREDICTED: LYR motif-containing protein At3g... 58 3e-06 gb|KMT01114.1| hypothetical protein BVRB_9g223660 [Beta vulgaris... 57 4e-06 ref|XP_010691653.1| PREDICTED: LYR motif-containing protein At3g... 57 4e-06 ref|XP_009346863.1| PREDICTED: LYR motif-containing protein At3g... 57 4e-06 ref|XP_011088199.1| PREDICTED: LYR motif-containing protein At3g... 57 5e-06 ref|XP_002268939.2| PREDICTED: LYR motif-containing protein At3g... 57 6e-06 >ref|XP_004289749.1| PREDICTED: LYR motif-containing protein At3g19508 [Fragaria vesca subsp. vesca] Length = 82 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 216 NDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 ND +LH+L NRAY HSLWVL KYSV++SAAD+ KKIC Sbjct: 43 NDDQALHDLFNRAYLHSLWVLNKYSVDESAADKLKKIC 80 >ref|XP_008456173.1| PREDICTED: LYR motif-containing protein At3g19508 [Cucumis melo] Length = 82 Score = 60.8 bits (146), Expect = 3e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKICYN 97 +ND+ SL EL +RAY HSLWVL KYSV+ SAAD+ K+ICY+ Sbjct: 42 ANDAKSLEELFHRAYNHSLWVLNKYSVDGSAADKLKEICYS 82 >ref|XP_006346350.1| PREDICTED: LYR motif-containing protein At3g19508-like [Solanum tuberosum] Length = 87 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 SND +L ELL R Y HSLWVL+KYSV+QSAADR K IC Sbjct: 47 SNDPNALQELLQRTYNHSLWVLKKYSVDQSAADRLKNIC 85 >ref|XP_004230727.1| PREDICTED: LYR motif-containing protein At3g19508 [Solanum lycopersicum] Length = 87 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 SND +L ELL R Y HSLWVL+KYSV+QSAADR K IC Sbjct: 47 SNDPNALQELLQRTYNHSLWVLKKYSVDQSAADRLKNIC 85 >ref|XP_009610038.1| PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana tomentosiformis] gi|697112325|ref|XP_009610039.1| PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana tomentosiformis] gi|697112327|ref|XP_009610040.1| PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana tomentosiformis] Length = 108 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 SND +L ELL R Y HSLWVL KYSV+QSAADR K IC Sbjct: 68 SNDPNALQELLQRTYNHSLWVLNKYSVDQSAADRLKNIC 106 >ref|XP_008380588.1| PREDICTED: LYR motif-containing protein At3g19508 [Malus domestica] Length = 82 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 +ND +LH+L RAY HSLWVL KYSV++SAAD+ KKIC Sbjct: 42 ANDDKALHDLFLRAYNHSLWVLNKYSVDESAADKLKKIC 80 >ref|XP_008236391.1| PREDICTED: LYR motif-containing protein At3g19508 [Prunus mume] Length = 82 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 + D +LHEL +RAY HSLWVL KYSV++SAAD+ KKIC Sbjct: 42 AGDDQALHELFHRAYKHSLWVLNKYSVDESAADKLKKIC 80 >ref|XP_012465891.1| PREDICTED: LYR motif-containing protein At3g19508 [Gossypium raimondii] gi|763811567|gb|KJB78419.1| hypothetical protein B456_013G048100 [Gossypium raimondii] Length = 86 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -3 Query: 228 FDASNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 FDAS DS +L EL +RAY HSLWVL KYSVN+SAA + K+IC Sbjct: 40 FDAS-DSKALDELFHRAYNHSLWVLNKYSVNESAAQKLKEIC 80 >gb|KHG30324.1| hypothetical protein F383_11007 [Gossypium arboreum] Length = 83 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -3 Query: 228 FDASNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKICYN 97 FDAS DS +L EL +RAY HSLWVL KYSV++SAA + K+IC++ Sbjct: 40 FDAS-DSKALDELFHRAYNHSLWVLNKYSVDESAAQKLKEICFH 82 >ref|XP_009758975.1| PREDICTED: LYR motif-containing protein At3g19508 [Nicotiana sylvestris] Length = 87 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 SND +L ELL RAY HS+WVL KYSV+QS ADR K IC Sbjct: 47 SNDPNALQELLQRAYNHSIWVLNKYSVDQSTADRLKIIC 85 >gb|KEH27327.1| UPF0631 plant-like protein [Medicago truncatula] Length = 83 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -3 Query: 216 NDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 +DST+LH+L R YTHSLWVL KYSV++S AD+ K IC Sbjct: 43 SDSTTLHDLFQRTYTHSLWVLHKYSVDESVADKLKVIC 80 >ref|XP_004511298.1| PREDICTED: LYR motif-containing protein At3g19508 [Cicer arietinum] Length = 82 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -3 Query: 216 NDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 +DS++LH+L R YTHSLWVL KYSV++SAAD+ K IC Sbjct: 43 SDSSTLHDLFQRTYTHSLWVLHKYSVDESAADKLKGIC 80 >ref|XP_007199065.1| hypothetical protein PRUPE_ppa018678mg [Prunus persica] gi|462394465|gb|EMJ00264.1| hypothetical protein PRUPE_ppa018678mg [Prunus persica] Length = 82 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 + D +LHEL +RAY HSLWVL KYSV++SAAD+ +KIC Sbjct: 42 AGDDQALHELFHRAYKHSLWVLNKYSVDESAADKLRKIC 80 >ref|XP_004140718.1| PREDICTED: LYR motif-containing protein At3g19508 [Cucumis sativus] gi|700202361|gb|KGN57494.1| hypothetical protein Csa_3G199560 [Cucumis sativus] Length = 82 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKICY 100 + D+ SL EL +RAY HSLWVL KYSV+ SAAD+ K+ICY Sbjct: 42 AQDAKSLEELFHRAYNHSLWVLNKYSVDGSAADKLKEICY 81 >ref|XP_008338262.1| PREDICTED: LYR motif-containing protein At3g19508-like [Malus domestica] Length = 82 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/39 (64%), Positives = 32/39 (82%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 +ND +LHEL RAY HSLWVL KY+V++SAA++ KKIC Sbjct: 42 ANDDQALHELFLRAYNHSLWVLNKYTVDESAANKLKKIC 80 >gb|KMT01114.1| hypothetical protein BVRB_9g223660 [Beta vulgaris subsp. vulgaris] Length = 83 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 + D+ ++ ELLNR YTHSLWVLQKYSV+ +AA++ K++C Sbjct: 42 ATDTAAIDELLNRTYTHSLWVLQKYSVDDAAAEKLKRVC 80 >ref|XP_010691653.1| PREDICTED: LYR motif-containing protein At3g19508 [Beta vulgaris subsp. vulgaris] gi|731360140|ref|XP_010691654.1| PREDICTED: LYR motif-containing protein At3g19508 [Beta vulgaris subsp. vulgaris] Length = 89 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/39 (58%), Positives = 33/39 (84%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 + D+ ++ ELLNR YTHSLWVLQKYSV+ +AA++ K++C Sbjct: 48 ATDTAAIDELLNRTYTHSLWVLQKYSVDDAAAEKLKRVC 86 >ref|XP_009346863.1| PREDICTED: LYR motif-containing protein At3g19508 [Pyrus x bretschneideri] Length = 82 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = -3 Query: 219 SNDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 +ND +L++L RAY HSLWVL+KYSV++SAAD+ KKIC Sbjct: 42 ANDDQALNDLFLRAYNHSLWVLKKYSVDESAADKLKKIC 80 >ref|XP_011088199.1| PREDICTED: LYR motif-containing protein At3g19508 [Sesamum indicum] Length = 87 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/38 (63%), Positives = 32/38 (84%) Frame = -3 Query: 216 NDSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 ND+ +L+ELLNR YTHSLWVL KYS+++S A + K+IC Sbjct: 48 NDAAALNELLNRTYTHSLWVLNKYSLDESVAGKLKEIC 85 >ref|XP_002268939.2| PREDICTED: LYR motif-containing protein At3g19508 [Vitis vinifera] gi|731383978|ref|XP_010647957.1| PREDICTED: LYR motif-containing protein At3g19508 [Vitis vinifera] gi|731383980|ref|XP_010647958.1| PREDICTED: LYR motif-containing protein At3g19508 [Vitis vinifera] gi|731383982|ref|XP_010647960.1| PREDICTED: LYR motif-containing protein At3g19508 [Vitis vinifera] gi|296083107|emb|CBI22511.3| unnamed protein product [Vitis vinifera] Length = 82 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = -3 Query: 213 DSTSLHELLNRAYTHSLWVLQKYSVNQSAADRSKKIC 103 D +L++L NR YTHSLWVL KYSV+Q+AAD+ K+IC Sbjct: 44 DPNALNDLFNRTYTHSLWVLNKYSVDQAAADKLKEIC 80