BLASTX nr result
ID: Anemarrhena21_contig00017785
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017785 (455 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008789534.1| PREDICTED: protein LUTEIN DEFICIENT 5, chlor... 57 6e-06 gb|KJB82189.1| hypothetical protein B456_013G180200 [Gossypium r... 56 8e-06 gb|KJB82188.1| hypothetical protein B456_013G180200 [Gossypium r... 56 8e-06 gb|KJB82187.1| hypothetical protein B456_013G180200 [Gossypium r... 56 8e-06 gb|KJB82186.1| hypothetical protein B456_013G180200 [Gossypium r... 56 8e-06 ref|XP_012464404.1| PREDICTED: protein LUTEIN DEFICIENT 5, chlor... 56 8e-06 gb|KJB82184.1| hypothetical protein B456_013G180200 [Gossypium r... 56 8e-06 gb|KHF99465.1| Cytochrome P450, chloroplastic [Gossypium arboreum] 56 8e-06 ref|XP_006340502.1| PREDICTED: protein LUTEIN DEFICIENT 5, chlor... 56 8e-06 >ref|XP_008789534.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Phoenix dactylifera] Length = 640 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 333 EQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTILS 455 + AVKEVE +LEEKRRA+LAARIASGEFT QSG I + S Sbjct: 63 DPAVKEVERLLEEKRRAQLAARIASGEFTAQQSGWISVVKS 103 >gb|KJB82189.1| hypothetical protein B456_013G180200 [Gossypium raimondii] Length = 517 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 49 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 90 >gb|KJB82188.1| hypothetical protein B456_013G180200 [Gossypium raimondii] Length = 603 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 49 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 90 >gb|KJB82187.1| hypothetical protein B456_013G180200 [Gossypium raimondii] Length = 512 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 49 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 90 >gb|KJB82186.1| hypothetical protein B456_013G180200 [Gossypium raimondii] Length = 591 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 24 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 65 >ref|XP_012464404.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic [Gossypium raimondii] gi|763815333|gb|KJB82185.1| hypothetical protein B456_013G180200 [Gossypium raimondii] Length = 616 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 49 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 90 >gb|KJB82184.1| hypothetical protein B456_013G180200 [Gossypium raimondii] Length = 614 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 49 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 90 >gb|KHF99465.1| Cytochrome P450, chloroplastic [Gossypium arboreum] Length = 572 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSGLIPTIL 452 DS++ VK VE +LEEKRRAEL+ARIASGEFTV +SG P++L Sbjct: 49 DSADNGVKSVERLLEEKRRAELSARIASGEFTVQKSG-FPSLL 90 >ref|XP_006340502.1| PREDICTED: protein LUTEIN DEFICIENT 5, chloroplastic-like [Solanum tuberosum] Length = 604 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +3 Query: 324 DSSEQAVKEVELMLEEKRRAELAARIASGEFTVDQSG 434 +S ++ VK+VE +LEEKRRAEL+ARIASGEFTV+QSG Sbjct: 45 ESVDEGVKKVEKLLEEKRRAELSARIASGEFTVEQSG 81