BLASTX nr result
ID: Anemarrhena21_contig00017767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017767 (402 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010933824.1| PREDICTED: anther-specific proline-rich prot... 60 6e-07 >ref|XP_010933824.1| PREDICTED: anther-specific proline-rich protein APG-like [Elaeis guineensis] Length = 182 Score = 60.1 bits (144), Expect = 6e-07 Identities = 33/67 (49%), Positives = 39/67 (58%), Gaps = 2/67 (2%) Frame = -2 Query: 308 LPYPAPPKAEI--RPLGAVXXXXXXXXPMAEVQKPKKGINEKVEDYISRTKGKIRIGSGD 135 +P PAPPKA +PL A +KPKK INEKVEDYI RTK ++R SG Sbjct: 116 MPQPAPPKAAATPQPLPQPAPPQGAAAAAAPTEKPKKNINEKVEDYIKRTKDRLRSVSGI 175 Query: 134 GRVPSSK 114 GR P+ K Sbjct: 176 GRTPTIK 182