BLASTX nr result
ID: Anemarrhena21_contig00017612
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017612 (321 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoder... 120 5e-25 gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [... 93 5e-22 dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella comp... 103 4e-20 ref|XP_003614391.1| Tar1p [Medicago truncatula] 91 3e-16 gb|KIN94649.1| hypothetical protein M404DRAFT_1008191, partial [... 88 2e-15 ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipol... 88 2e-15 ref|XP_009534205.1| hypothetical protein PHYSODRAFT_287468 [Phyt... 84 3e-14 ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melam... 75 4e-14 ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melam... 75 4e-14 ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melam... 75 4e-14 ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melam... 75 4e-14 gb|KIJ40872.1| hypothetical protein M422DRAFT_173118, partial [S... 69 4e-14 gb|KIK49844.1| hypothetical protein GYMLUDRAFT_183501, partial [... 81 3e-13 gb|KII82787.1| hypothetical protein PLICRDRAFT_58628 [Plicaturop... 80 7e-13 gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [P... 80 7e-13 ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 80 7e-13 gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trif... 79 9e-13 gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379, partial ... 79 9e-13 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 78 2e-12 ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melam... 78 3e-12 >gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 120 bits (300), Expect = 5e-25 Identities = 50/54 (92%), Positives = 50/54 (92%) Frame = -1 Query: 162 MGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 MG R KGPAGPVHAVRRTGQPGPRFNYELFN NNFNIRYWSWNYRGCWHQTCP Sbjct: 1 MGFRRGKGPAGPVHAVRRTGQPGPRFNYELFNHNNFNIRYWSWNYRGCWHQTCP 54 >gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [Botryobasidium botryosum FD-172 SS1] gi|646295020|gb|KDQ16185.1| hypothetical protein BOTBODRAFT_107195, partial [Botryobasidium botryosum FD-172 SS1] Length = 76 Score = 92.8 bits (229), Expect(2) = 5e-22 Identities = 42/66 (63%), Positives = 42/66 (63%) Frame = -1 Query: 198 KSPGSPAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGC 19 K PGSP HPVKGM P H FNYELFNCNNFNIRYWSWNYRGC Sbjct: 25 KRPGSPTHPVKGM----------PAH---------QEFNYELFNCNNFNIRYWSWNYRGC 65 Query: 18 WHQTCP 1 WHQTCP Sbjct: 66 WHQTCP 71 Score = 38.1 bits (87), Expect(2) = 5e-22 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 319 PINHYGGSRNQQNRTAR 269 PINHYG SRNQQNRTAR Sbjct: 8 PINHYGDSRNQQNRTAR 24 >dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 103 bits (257), Expect = 4e-20 Identities = 53/80 (66%), Positives = 56/80 (70%) Frame = -3 Query: 319 PINHYGGSRNQQNRTARPILLFHANVFEQRPALNTLIFSK*KSWFPRTPSEGHGALQKER 140 PINHYGG RNQQNRT RPILLFHANVFEQ PALNTLIFS QKER Sbjct: 82 PINHYGGPRNQQNRTTRPILLFHANVFEQMPALNTLIFSN----------------QKER 125 Query: 139 PGRTSTRGEADRPARPKIQL 80 PGR S+ EADRP RPK++L Sbjct: 126 PGRVSSHREADRPTRPKLEL 145 >ref|XP_003614391.1| Tar1p [Medicago truncatula] Length = 553 Score = 90.9 bits (224), Expect = 3e-16 Identities = 38/50 (76%), Positives = 39/50 (78%) Frame = -1 Query: 150 RRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 RR P G H RRT +P PR NYELFNCNN NIRYWSWNYRGCWHQTCP Sbjct: 501 RRDEPTGAHH--RRTDRPNPRSNYELFNCNNLNIRYWSWNYRGCWHQTCP 548 >gb|KIN94649.1| hypothetical protein M404DRAFT_1008191, partial [Pisolithus tinctorius Marx 270] Length = 54 Score = 88.2 bits (217), Expect = 2e-15 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = -1 Query: 147 RKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 +KGPA A T PGPRFNYELF+CNNFNIRYWSWNY CWHQTCP Sbjct: 1 KKGPARQYDAFWWTACPGPRFNYELFDCNNFNIRYWSWNYCSCWHQTCP 49 >ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] gi|477581303|gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 87.8 bits (216), Expect = 2e-15 Identities = 37/61 (60%), Positives = 40/61 (65%) Frame = -1 Query: 183 PAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTC 4 P PV G+SR + + P P FNYELFNCNNFNIRYWSWNYRGCWHQTC Sbjct: 3 PTVPVNHCGVSRNQQNRNARPILLFHANPDPSFNYELFNCNNFNIRYWSWNYRGCWHQTC 62 Query: 3 P 1 P Sbjct: 63 P 63 >ref|XP_009534205.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] gi|695467858|ref|XP_009539727.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348665049|gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348671639|gb|EGZ11460.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] Length = 55 Score = 84.3 bits (207), Expect = 3e-14 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = -1 Query: 111 RTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 RTG P + NYELFNCNNFNIRYWSWNYRGCWHQTCP Sbjct: 14 RTGHPKQKSNYELFNCNNFNIRYWSWNYRGCWHQTCP 50 >ref|XP_007419024.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] gi|328848488|gb|EGF97701.1| hypothetical protein MELLADRAFT_84532 [Melampsora larici-populina 98AG31] Length = 146 Score = 75.5 bits (184), Expect(2) = 4e-14 Identities = 35/67 (52%), Positives = 39/67 (58%) Frame = -1 Query: 201 SKSPGSPAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRG 22 S PGS HPVK + + + F+YELFN NNFNIRYWSWNYRG Sbjct: 62 SNIPGSLQHPVKCIKVHQE-------------------FDYELFNVNNFNIRYWSWNYRG 102 Query: 21 CWHQTCP 1 CWHQTCP Sbjct: 103 CWHQTCP 109 Score = 28.9 bits (63), Expect(2) = 4e-14 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 319 PINHYGGSRNQQN 281 PINHYG RNQQN Sbjct: 49 PINHYGDPRNQQN 61 >ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] gi|328852044|gb|EGG01193.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] Length = 130 Score = 75.5 bits (184), Expect(2) = 4e-14 Identities = 35/67 (52%), Positives = 39/67 (58%) Frame = -1 Query: 201 SKSPGSPAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRG 22 S PGS HPVK + + + F+YELFN NNFNIRYWSWNYRG Sbjct: 46 SNIPGSLQHPVKCIKVHQE-------------------FDYELFNVNNFNIRYWSWNYRG 86 Query: 21 CWHQTCP 1 CWHQTCP Sbjct: 87 CWHQTCP 93 Score = 28.9 bits (63), Expect(2) = 4e-14 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 319 PINHYGGSRNQQN 281 PINHYG RNQQN Sbjct: 33 PINHYGDPRNQQN 45 >ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] gi|599406978|ref|XP_007413435.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|599420165|ref|XP_007416289.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|599426092|ref|XP_007417784.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328849783|gb|EGF98957.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328851287|gb|EGG00443.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|328854166|gb|EGG03300.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|328861970|gb|EGG11072.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 75.5 bits (184), Expect(2) = 4e-14 Identities = 35/67 (52%), Positives = 39/67 (58%) Frame = -1 Query: 201 SKSPGSPAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRG 22 S PGS HPVK + + + F+YELFN NNFNIRYWSWNYRG Sbjct: 19 SNIPGSLQHPVKCIKVHQE-------------------FDYELFNVNNFNIRYWSWNYRG 59 Query: 21 CWHQTCP 1 CWHQTCP Sbjct: 60 CWHQTCP 66 Score = 28.9 bits (63), Expect(2) = 4e-14 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 319 PINHYGGSRNQQN 281 PINHYG RNQQN Sbjct: 6 PINHYGDPRNQQN 18 >ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] gi|328852954|gb|EGG02096.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] Length = 71 Score = 75.5 bits (184), Expect(2) = 4e-14 Identities = 35/67 (52%), Positives = 39/67 (58%) Frame = -1 Query: 201 SKSPGSPAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRG 22 S PGS HPVK + + + F+YELFN NNFNIRYWSWNYRG Sbjct: 19 SNIPGSLQHPVKCIKVHQE-------------------FDYELFNVNNFNIRYWSWNYRG 59 Query: 21 CWHQTCP 1 CWHQTCP Sbjct: 60 CWHQTCP 66 Score = 28.9 bits (63), Expect(2) = 4e-14 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = -3 Query: 319 PINHYGGSRNQQN 281 PINHYG RNQQN Sbjct: 6 PINHYGDPRNQQN 18 >gb|KIJ40872.1| hypothetical protein M422DRAFT_173118, partial [Sphaerobolus stellatus SS14] Length = 75 Score = 69.3 bits (168), Expect(2) = 4e-14 Identities = 32/63 (50%), Positives = 38/63 (60%) Frame = -1 Query: 189 GSPAHPVKGMGLSRRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQ 10 GSP HP+K + + +G +H FNY+LFN NNFNI YWSWNY GCWHQ Sbjct: 21 GSPRHPIKDIK-AHHQGTL--IHT----------FNYKLFNSNNFNIHYWSWNYCGCWHQ 67 Query: 9 TCP 1 CP Sbjct: 68 ICP 70 Score = 35.0 bits (79), Expect(2) = 4e-14 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 319 PINHYGGSRNQQNRT 275 PINHYG SRNQQNRT Sbjct: 4 PINHYGNSRNQQNRT 18 >gb|KIK49844.1| hypothetical protein GYMLUDRAFT_183501, partial [Gymnopus luxurians FD-317 M1] Length = 79 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/68 (55%), Positives = 41/68 (60%), Gaps = 4/68 (5%) Frame = -1 Query: 192 PGSPAHPVKGMGLSRRKGPAGPVHAVRRTGQP----GPRFNYELFNCNNFNIRYWSWNYR 25 P P P+ G SR + RT +P FNYELFNCNNFNIRYWSWNYR Sbjct: 15 PMPPTIPINHYGDSRNQQ--------NRTARPILLFHANFNYELFNCNNFNIRYWSWNYR 66 Query: 24 GCWHQTCP 1 GCWHQTCP Sbjct: 67 GCWHQTCP 74 >gb|KII82787.1| hypothetical protein PLICRDRAFT_58628 [Plicaturopsis crispa FD-325 SS-3] Length = 64 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/65 (56%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = -1 Query: 183 PAHPVKGMGLSRRKGPAGPVHAVRRTGQP----GPRFNYELFNCNNFNIRYWSWNYRGCW 16 P P+ G SR + RT +P FNYELFNCNNFNIRYWSWNYRGCW Sbjct: 3 PTVPINHYGDSRNQQ--------NRTARPILLFHANFNYELFNCNNFNIRYWSWNYRGCW 54 Query: 15 HQTCP 1 HQTCP Sbjct: 55 HQTCP 59 >gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [Pleurotus ostreatus PC15] Length = 74 Score = 79.7 bits (195), Expect = 7e-13 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 90 RFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 +FNYELFNCNNFNIRYWSWNYRGCWHQTCP Sbjct: 40 KFNYELFNCNNFNIRYWSWNYRGCWHQTCP 69 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gi|395323025|gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/65 (56%), Positives = 40/65 (61%), Gaps = 4/65 (6%) Frame = -1 Query: 183 PAHPVKGMGLSRRKGPAGPVHAVRRTGQP----GPRFNYELFNCNNFNIRYWSWNYRGCW 16 P P+ G SR + RT +P FNYELFNCNNFNIRYWSWNYRGCW Sbjct: 5 PTIPINHYGDSRNQQ--------NRTARPILLFHANFNYELFNCNNFNIRYWSWNYRGCW 56 Query: 15 HQTCP 1 HQTCP Sbjct: 57 HQTCP 61 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trifallax] Length = 111 Score = 79.3 bits (194), Expect = 9e-13 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 114 RRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 + T P + NYELFNCNNFNIRYWSWNYRGCWHQTCP Sbjct: 10 KTTLAPSQKSNYELFNCNNFNIRYWSWNYRGCWHQTCP 47 >gb|EGN91453.1| hypothetical protein SERLA73DRAFT_67379, partial [Serpula lacrymans var. lacrymans S7.3] Length = 80 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/66 (56%), Positives = 39/66 (59%), Gaps = 4/66 (6%) Frame = -1 Query: 186 SPAHPVKGMGLSRRKGPAGPVHAVRRTGQP----GPRFNYELFNCNNFNIRYWSWNYRGC 19 SP P+ G SR + RT P FNYELFNCNNFNI YWSWNYRGC Sbjct: 18 SPTVPINHYGNSRNQQ--------NRTAHPILLFHANFNYELFNCNNFNIHYWSWNYRGC 69 Query: 18 WHQTCP 1 WHQTCP Sbjct: 70 WHQTCP 75 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 78.2 bits (191), Expect = 2e-12 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = -1 Query: 150 RRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 R K P R+T +F+YELFN NNFNIRYWSWNYRGCWHQTCP Sbjct: 27 RGKHPTNQYTPKRQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQTCP 76 >ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] gi|328853743|gb|EGG02880.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] Length = 134 Score = 77.8 bits (190), Expect = 3e-12 Identities = 32/50 (64%), Positives = 35/50 (70%) Frame = -1 Query: 150 RRKGPAGPVHAVRRTGQPGPRFNYELFNCNNFNIRYWSWNYRGCWHQTCP 1 R K P R+T +F+YELFN NNFNIRYWSWNYRGCWHQTCP Sbjct: 48 RGKYPTNQYTPKRQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQTCP 97