BLASTX nr result
ID: Anemarrhena21_contig00017609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00017609 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella comp... 102 1e-19 gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [... 84 2e-19 gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoder... 101 2e-19 ref|XP_003614391.1| Tar1p [Medicago truncatula] 82 2e-13 ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipol... 80 4e-13 gb|KIJ40872.1| hypothetical protein M422DRAFT_173118, partial [S... 62 2e-12 ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melam... 66 2e-12 ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melam... 66 2e-12 gb|KIN94649.1| hypothetical protein M404DRAFT_1008191, partial [... 78 2e-12 ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melam... 66 2e-12 ref|WP_029467737.1| hypothetical protein [Hungatella hathewayi] 75 2e-11 ref|XP_009534205.1| hypothetical protein PHYSODRAFT_287468 [Phyt... 75 2e-11 gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [P... 74 5e-11 ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melam... 74 5e-11 gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trif... 73 6e-11 ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melam... 73 6e-11 gb|KIK49844.1| hypothetical protein GYMLUDRAFT_183501, partial [... 72 1e-10 gb|KII82787.1| hypothetical protein PLICRDRAFT_58628 [Plicaturop... 71 3e-10 ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, part... 71 3e-10 ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, parti... 71 3e-10 >dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 102 bits (254), Expect = 1e-19 Identities = 51/81 (62%), Positives = 56/81 (69%) Frame = +1 Query: 1 IPINHYGNPRNQQNRTARPVLLFHANIFEQRPALNTLIFSK*KSWFPNTPSEGHEVLQKE 180 IPINHYG PRNQQNRT RP+LLFHAN+FEQ PALNTLIFS QKE Sbjct: 81 IPINHYGGPRNQQNRTTRPILLFHANVFEQMPALNTLIFSN----------------QKE 124 Query: 181 RPGRTSARGEADPPARPKIQL 243 RPGR S+ EAD P RPK++L Sbjct: 125 RPGRVSSHREADRPTRPKLEL 145 >gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [Botryobasidium botryosum FD-172 SS1] gi|646295020|gb|KDQ16185.1| hypothetical protein BOTBODRAFT_107195, partial [Botryobasidium botryosum FD-172 SS1] Length = 76 Score = 84.0 bits (206), Expect(2) = 2e-19 Identities = 40/63 (63%), Positives = 41/63 (65%) Frame = +2 Query: 125 KSPGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGC 304 K PGSPT PVKGM PA Q +FNYELFNCNNFNIRYWSWNYRGC Sbjct: 25 KRPGSPTHPVKGM-------PAHQ------------EFNYELFNCNNFNIRYWSWNYRGC 65 Query: 305 WHQ 313 WHQ Sbjct: 66 WHQ 68 Score = 38.1 bits (87), Expect(2) = 2e-19 Identities = 15/18 (83%), Positives = 17/18 (94%) Frame = +1 Query: 1 IPINHYGNPRNQQNRTAR 54 +PINHYG+ RNQQNRTAR Sbjct: 7 VPINHYGDSRNQQNRTAR 24 >gb|EHK48568.1| hypothetical protein TRIATDRAFT_255346 [Trichoderma atroviride IMI 206040] Length = 59 Score = 101 bits (251), Expect = 2e-19 Identities = 43/51 (84%), Positives = 44/51 (86%) Frame = +2 Query: 161 MRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 M F R KGPAG VHAVRRT QP P+FNYELFN NNFNIRYWSWNYRGCWHQ Sbjct: 1 MGFRRGKGPAGPVHAVRRTGQPGPRFNYELFNHNNFNIRYWSWNYRGCWHQ 51 >ref|XP_003614391.1| Tar1p [Medicago truncatula] Length = 553 Score = 81.6 bits (200), Expect = 2e-13 Identities = 34/47 (72%), Positives = 37/47 (78%) Frame = +2 Query: 173 RRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 RR P G H RRT +P+P+ NYELFNCNN NIRYWSWNYRGCWHQ Sbjct: 501 RRDEPTGAHH--RRTDRPNPRSNYELFNCNNLNIRYWSWNYRGCWHQ 545 >ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] gi|477581303|gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/58 (60%), Positives = 37/58 (63%) Frame = +2 Query: 140 PTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 PT PV SR + + PDP FNYELFNCNNFNIRYWSWNYRGCWHQ Sbjct: 3 PTVPVNHCGVSRNQQNRNARPILLFHANPDPSFNYELFNCNNFNIRYWSWNYRGCWHQ 60 >gb|KIJ40872.1| hypothetical protein M422DRAFT_173118, partial [Sphaerobolus stellatus SS14] Length = 75 Score = 62.0 bits (149), Expect(2) = 2e-12 Identities = 29/60 (48%), Positives = 36/60 (60%) Frame = +2 Query: 134 GSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 GSP P+K ++ + +G +H FNY+LFN NNFNI YWSWNY GCWHQ Sbjct: 21 GSPRHPIKDIK-AHHQGTL--IHT----------FNYKLFNSNNFNIHYWSWNYCGCWHQ 67 Score = 37.0 bits (84), Expect(2) = 2e-12 Identities = 15/16 (93%), Positives = 15/16 (93%) Frame = +1 Query: 1 IPINHYGNPRNQQNRT 48 IPINHYGN RNQQNRT Sbjct: 3 IPINHYGNSRNQQNRT 18 >ref|XP_007415543.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] gi|328852044|gb|EGG01193.1| hypothetical protein MELLADRAFT_92712 [Melampsora larici-populina 98AG31] Length = 130 Score = 65.9 bits (159), Expect(2) = 2e-12 Identities = 33/64 (51%), Positives = 37/64 (57%) Frame = +2 Query: 122 SKSPGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRG 301 S PGS PVK ++ VH +F+YELFN NNFNIRYWSWNYRG Sbjct: 46 SNIPGSLQHPVKCIK----------VHQ---------EFDYELFNVNNFNIRYWSWNYRG 86 Query: 302 CWHQ 313 CWHQ Sbjct: 87 CWHQ 90 Score = 32.7 bits (73), Expect(2) = 2e-12 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 4 PINHYGNPRNQQN 42 PINHYG+PRNQQN Sbjct: 33 PINHYGDPRNQQN 45 >ref|XP_007405674.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] gi|599406978|ref|XP_007413435.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|599420165|ref|XP_007416289.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|599426092|ref|XP_007417784.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328849783|gb|EGF98957.1| hypothetical protein MELLADRAFT_95029 [Melampsora larici-populina 98AG31] gi|328851287|gb|EGG00443.1| hypothetical protein MELLADRAFT_93286 [Melampsora larici-populina 98AG31] gi|328854166|gb|EGG03300.1| hypothetical protein MELLADRAFT_90342 [Melampsora larici-populina 98AG31] gi|328861970|gb|EGG11072.1| hypothetical protein MELLADRAFT_92520 [Melampsora larici-populina 98AG31] Length = 103 Score = 65.9 bits (159), Expect(2) = 2e-12 Identities = 33/64 (51%), Positives = 37/64 (57%) Frame = +2 Query: 122 SKSPGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRG 301 S PGS PVK ++ VH +F+YELFN NNFNIRYWSWNYRG Sbjct: 19 SNIPGSLQHPVKCIK----------VHQ---------EFDYELFNVNNFNIRYWSWNYRG 59 Query: 302 CWHQ 313 CWHQ Sbjct: 60 CWHQ 63 Score = 32.7 bits (73), Expect(2) = 2e-12 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 4 PINHYGNPRNQQN 42 PINHYG+PRNQQN Sbjct: 6 PINHYGDPRNQQN 18 >gb|KIN94649.1| hypothetical protein M404DRAFT_1008191, partial [Pisolithus tinctorius Marx 270] Length = 54 Score = 78.2 bits (191), Expect = 2e-12 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +2 Query: 176 RKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 +KGPA Q A T P P+FNYELF+CNNFNIRYWSWNY CWHQ Sbjct: 1 KKGPARQYDAFWWTACPGPRFNYELFDCNNFNIRYWSWNYCSCWHQ 46 >ref|XP_007414633.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] gi|328852954|gb|EGG02096.1| hypothetical protein MELLADRAFT_91703 [Melampsora larici-populina 98AG31] Length = 71 Score = 65.9 bits (159), Expect(2) = 2e-12 Identities = 33/64 (51%), Positives = 37/64 (57%) Frame = +2 Query: 122 SKSPGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRG 301 S PGS PVK ++ VH +F+YELFN NNFNIRYWSWNYRG Sbjct: 19 SNIPGSLQHPVKCIK----------VHQ---------EFDYELFNVNNFNIRYWSWNYRG 59 Query: 302 CWHQ 313 CWHQ Sbjct: 60 CWHQ 63 Score = 32.7 bits (73), Expect(2) = 2e-12 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +1 Query: 4 PINHYGNPRNQQN 42 PINHYG+PRNQQN Sbjct: 6 PINHYGDPRNQQN 18 >ref|WP_029467737.1| hypothetical protein [Hungatella hathewayi] Length = 130 Score = 74.7 bits (182), Expect = 2e-11 Identities = 40/75 (53%), Positives = 44/75 (58%) Frame = +1 Query: 1 IPINHYGNPRNQQNRTARPVLLFHANIFEQRPALNTLIFSK*KSWFPNTPSEGHEVLQKE 180 +PINHY PRNQQNRT RP+LLFHANIFEQ F K K P +G QKE Sbjct: 5 VPINHYDGPRNQQNRTKRPILLFHANIFEQYACFEHSNFFKVKVLVHQGP-QGPRASQKE 63 Query: 181 RPGRTSARGEADPPA 225 RPGR + E PA Sbjct: 64 RPGRKNQYAEKSGPA 78 >ref|XP_009534205.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] gi|695467858|ref|XP_009539727.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348665049|gb|EGZ04885.1| hypothetical protein PHYSODRAFT_291676 [Phytophthora sojae] gi|348671639|gb|EGZ11460.1| hypothetical protein PHYSODRAFT_287468 [Phytophthora sojae] Length = 55 Score = 74.7 bits (182), Expect = 2e-11 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = +2 Query: 212 RTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 RT P K NYELFNCNNFNIRYWSWNYRGCWHQ Sbjct: 14 RTGHPKQKSNYELFNCNNFNIRYWSWNYRGCWHQ 47 >gb|KDQ32289.1| hypothetical protein PLEOSDRAFT_23300, partial [Pleurotus ostreatus PC15] Length = 74 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/61 (55%), Positives = 37/61 (60%) Frame = +2 Query: 131 PGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWH 310 P PT P+ SR + + R KFNYELFNCNNFNIRYWSWNYRGCWH Sbjct: 16 PMPPTIPINHYGDSRNQ----------QNRTARLKFNYELFNCNNFNIRYWSWNYRGCWH 65 Query: 311 Q 313 Q Sbjct: 66 Q 66 >ref|XP_007417431.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] gi|328850152|gb|EGF99321.1| hypothetical protein MELLADRAFT_94729 [Melampsora larici-populina 98AG31] Length = 113 Score = 73.6 bits (179), Expect = 5e-11 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = +2 Query: 173 RRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 R K P Q R+T KF+YELFN NNFNIRYWSWNYRGCWHQ Sbjct: 27 RGKHPTNQYTPKRQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQ 73 >gb|EJY66654.1| hypothetical protein OXYTRI_13059 [Oxytricha trifallax] Length = 111 Score = 73.2 bits (178), Expect = 6e-11 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = +2 Query: 209 RRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 + T P K NYELFNCNNFNIRYWSWNYRGCWHQ Sbjct: 10 KTTLAPSQKSNYELFNCNNFNIRYWSWNYRGCWHQ 44 >ref|XP_007413993.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] gi|328853743|gb|EGG02880.1| hypothetical protein MELLADRAFT_90623 [Melampsora larici-populina 98AG31] Length = 134 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/47 (65%), Positives = 33/47 (70%) Frame = +2 Query: 173 RRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWHQ 313 R K P Q R+T KF+YELFN NNFNIRYWSWNYRGCWHQ Sbjct: 48 RGKYPTNQYTPKRQTSHQTLKFDYELFNVNNFNIRYWSWNYRGCWHQ 94 >gb|KIK49844.1| hypothetical protein GYMLUDRAFT_183501, partial [Gymnopus luxurians FD-317 M1] Length = 79 Score = 72.0 bits (175), Expect = 1e-10 Identities = 35/65 (53%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = +2 Query: 131 PGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQP----DPKFNYELFNCNNFNIRYWSWNYR 298 P PT P+ SR + RT +P FNYELFNCNNFNIRYWSWNYR Sbjct: 15 PMPPTIPINHYGDSRNQQ--------NRTARPILLFHANFNYELFNCNNFNIRYWSWNYR 66 Query: 299 GCWHQ 313 GCWHQ Sbjct: 67 GCWHQ 71 >gb|KII82787.1| hypothetical protein PLICRDRAFT_58628 [Plicaturopsis crispa FD-325 SS-3] Length = 64 Score = 70.9 bits (172), Expect = 3e-10 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 236 FNYELFNCNNFNIRYWSWNYRGCWHQ 313 FNYELFNCNNFNIRYWSWNYRGCWHQ Sbjct: 31 FNYELFNCNNFNIRYWSWNYRGCWHQ 56 >ref|XP_007335665.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] gi|409072524|gb|EKM73697.1| hypothetical protein AGABI1DRAFT_49393, partial [Agaricus bisporus var. burnettii JB137-S8] Length = 73 Score = 70.9 bits (172), Expect = 3e-10 Identities = 33/61 (54%), Positives = 36/61 (59%) Frame = +2 Query: 131 PGSPTRPVKGMRFSRRKGPAGQVHAVRRTRQPDPKFNYELFNCNNFNIRYWSWNYRGCWH 310 P PT P+ SR + + R KFNY LFNCNNFNIRYWSWNYRGCWH Sbjct: 15 PMPPTIPINHYGDSRNQ----------QNRTARLKFNYGLFNCNNFNIRYWSWNYRGCWH 64 Query: 311 Q 313 Q Sbjct: 65 Q 65 >ref|XP_007371709.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] gi|395323025|gb|EJF55554.1| hypothetical protein DICSQDRAFT_73523, partial [Dichomitus squalens LYAD-421 SS1] Length = 66 Score = 70.9 bits (172), Expect = 3e-10 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = +2 Query: 236 FNYELFNCNNFNIRYWSWNYRGCWHQ 313 FNYELFNCNNFNIRYWSWNYRGCWHQ Sbjct: 33 FNYELFNCNNFNIRYWSWNYRGCWHQ 58